BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0904 (400 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q00YT9 Cluster: CG6170-PA, isoform A; n=2; Ostreococcus... 34 0.89 UniRef50_Q8IYL2 Cluster: Putative methyltransferase UPF0383; n=1... 31 6.3 >UniRef50_Q00YT9 Cluster: CG6170-PA, isoform A; n=2; Ostreococcus tauri|Rep: CG6170-PA, isoform A - Ostreococcus tauri Length = 176 Score = 34.3 bits (75), Expect = 0.89 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 395 GALTTXVCGRYQHACLSPAPSTAAEYYTKDYDD*QGTWCY 276 GA CGRYQ+AC S +A +DD WCY Sbjct: 111 GACGKSFCGRYQNACAKKHASESAHDVCVSWDD-MSCWCY 149 >UniRef50_Q8IYL2 Cluster: Putative methyltransferase UPF0383; n=18; Tetrapoda|Rep: Putative methyltransferase UPF0383 - Homo sapiens (Human) Length = 757 Score = 31.5 bits (68), Expect = 6.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 8 CRYLYLPTVFLDFISVYVCRFKSSQQI*KYLDY 106 CR+ LP F DFI Y R Q +YLD+ Sbjct: 442 CRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDF 474 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 296,384,688 Number of Sequences: 1657284 Number of extensions: 4374125 Number of successful extensions: 6317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6317 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16926675320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -