BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0904 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 3.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 20 7.8 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.4 bits (43), Expect = 3.4 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 8 CRYLYLPTVFLDFISVYVCR-FKSSQQI*KYLDYTST 115 C ++YL TV+ + SV+ + K++ +TST Sbjct: 148 CYFIYLFTVYYIYYSVHEASIINFGYTLAKFMIFTST 184 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.2 bits (40), Expect = 7.8 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = -3 Query: 146 VNATSTDNLIMYLCSLSIFKFV 81 +N N+ M+LC++S+ + Sbjct: 268 INGQGQFNIEMFLCNMSLLTVI 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,605 Number of Sequences: 336 Number of extensions: 1235 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -