BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0901 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 23 1.0 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 23 1.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 9.4 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 23.4 bits (48), Expect = 1.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 233 RWFITNNMFSYTKCFDRYLSMKIW 162 ++ I N + S T CF L ++IW Sbjct: 157 QYHICNTVISATVCFMMLLMLEIW 180 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 23.4 bits (48), Expect = 1.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 233 RWFITNNMFSYTKCFDRYLSMKIW 162 ++ I N + S T CF L ++IW Sbjct: 153 QYHICNTVISATVCFMMLLMLEIW 176 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 9.4 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = +3 Query: 156 CAPNLHAQISVKALGIGKHVVCDKPAGLCQAEALKMARAAQ 278 CAP LH + + CD + + + + A+ AQ Sbjct: 1307 CAPGLHWDNNKNICDWPEKATCDGTSNVNVVDIVTTAKPAQ 1347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,643 Number of Sequences: 336 Number of extensions: 2074 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -