BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0900 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 48 2e-07 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.6 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 8.4 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 8.4 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 8.4 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 8.4 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 48.4 bits (110), Expect = 2e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 452 NAVITVXAYFNDSQRQATKDAGTISG 529 +AVITV AYFNDSQRQATKDAG I+G Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAG 26 Score = 40.7 bits (91), Expect = 4e-05 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +3 Query: 531 LNVLRIXNEPTAAAIALRVLTKRVPGRTKXYXIFDLGGG 647 LNV+RI NEPTAAA+A L K + G + IFDLGGG Sbjct: 27 LNVMRIINEPTAAALAYG-LDKNLKGE-RNVLIFDLGGG 63 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.6 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 30 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 131 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 442 NCAXCSYHGXRVLQ*LSKTSHKR-CRY 519 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 442 NCAXCSYHGXRVLQ*LSKTSHKR-CRY 519 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 442 NCAXCSYHGXRVLQ*LSKTSHKR-CRY 519 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 442 NCAXCSYHGXRVLQ*LSKTSHKR-CRY 519 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,324 Number of Sequences: 2352 Number of extensions: 14173 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -