BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0891 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 26 0.71 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 26 0.71 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 26 0.71 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 24 2.9 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.6 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 8.8 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 8.8 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 26.2 bits (55), Expect = 0.71 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 342 YDFIIVGGGSAGCVLANRLTEV 407 YD +++GGGS G A + ++ Sbjct: 38 YDLVVIGGGSGGLACAKQAVQL 59 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 26.2 bits (55), Expect = 0.71 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 342 YDFIIVGGGSAGCVLANRLTEV 407 YD +++GGGS G A + ++ Sbjct: 14 YDLVVIGGGSGGLACAKQAVQL 35 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 26.2 bits (55), Expect = 0.71 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 342 YDFIIVGGGSAGCVLANRLTEV 407 YD +++GGGS G A + ++ Sbjct: 11 YDLVVIGGGSGGLACAKQAVQL 32 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 24.2 bits (50), Expect = 2.9 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 454 LGGSSPASIISTDQLATSVSLLASTQPADPPPTI 353 L G +S +Q AT L + +PADP I Sbjct: 407 LSGMVAVPPLSVEQFATRFGLADTERPADPTAVI 440 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 6.6 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 312 AHANVPADSSYDFIIVGGGSAGCVLANRLTEVANWSVLMIEAGDDPPSIANSAR 473 +H VPAD GG+A +N +AN + AG P + + R Sbjct: 1192 SHQEVPADELMKKDATLGGNATTSTSNEAHVIANGHDGPVSAGKPPQAPPKAKR 1245 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.6 bits (46), Expect = 8.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 454 LGGSSPASIISTDQLATSVSLLASTQPADPPPT 356 L G I QLA QPA PPPT Sbjct: 452 LRGLGECGIKRAQQLAILRYARGPYQPASPPPT 484 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 22.6 bits (46), Expect = 8.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 454 LGGSSPASIISTDQLATSVSLLASTQPADPPPT 356 L G I QLA QPA PPPT Sbjct: 452 LRGLGECGIKRAQQLAILRYARGPYQPASPPPT 484 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,639 Number of Sequences: 2352 Number of extensions: 8203 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -