SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0891
         (550 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    71   1e-14
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          21   8.2  
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    21   8.2  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      21   8.2  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          21   8.2  

>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 70.5 bits (165), Expect = 1e-14
 Identities = 31/55 (56%), Positives = 41/55 (74%)
 Frame = +3

Query: 291 IGEPLYPAHANVPADSSYDFIIVGGGSAGCVLANRLTEVANWSVLMIEAGDDPPS 455
           IGEP    H++   D SYDFI+VGGG+A  V+A RL+EV+NW VL++EAG D P+
Sbjct: 52  IGEPCQRVHSSRIPDLSYDFIVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDEPA 106


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = -3

Query: 521 PKYPQFGSKVEVI 483
           PKY +FG +V+++
Sbjct: 520 PKYDEFGHEVDLV 532


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 6/20 (30%), Positives = 12/20 (60%)
 Frame = -3

Query: 461 SYAWRVVASFYHQHRPIGDF 402
           S +WR+  + ++ + P G F
Sbjct: 216 SRSWRITNNLFYPYPPYGTF 235


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = -3

Query: 521 PKYPQFGSKVEVI 483
           PKY +FG +V+++
Sbjct: 520 PKYDEFGHEVDLV 532


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = -3

Query: 521 PKYPQFGSKVEVI 483
           PKY +FG +V+++
Sbjct: 146 PKYDEFGHEVDLV 158


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,634
Number of Sequences: 438
Number of extensions: 2515
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15704448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -