BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0889 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) 281 3e-76 SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) 122 1e-28 SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) 97 6e-21 SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) 58 5e-09 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 54 8e-08 SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) 40 0.002 SB_44697| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) 29 3.3 SB_35782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) 28 4.4 SB_42892| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-06) 28 5.8 >SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) Length = 293 Score = 281 bits (689), Expect = 3e-76 Identities = 127/135 (94%), Positives = 129/135 (95%) Frame = +3 Query: 102 SKPGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRXXEYGGF 281 S+PG NVQLTE EI+GLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLR EYGGF Sbjct: 22 SRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGF 81 Query: 282 PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENXFLLRGNHECASINRIYGXYDECK 461 PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPEN FLLRGNHECASINRIYG YDECK Sbjct: 82 PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK 141 Query: 462 RRYNIKLWKTFTDCF 506 RRYNIKLWKTFTDCF Sbjct: 142 RRYNIKLWKTFTDCF 156 Score = 31.9 bits (69), Expect = 0.36 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 505 FNCLPVAAIVDXKIF 549 FNCLPVAAI+D KIF Sbjct: 156 FNCLPVAAILDEKIF 170 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = +2 Query: 44 DTDELNIDNVIKKLLKVRGEQ 106 + ++LN+D++I +LL+VRG + Sbjct: 3 EPEKLNVDSIISRLLEVRGSR 23 >SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) Length = 173 Score = 122 bits (295), Expect = 1e-28 Identities = 57/130 (43%), Positives = 79/130 (60%), Gaps = 1/130 (0%) Frame = +3 Query: 126 LTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRXXEYGGFPPESNYLF 305 L E ++K LC E+ L + + + +P+ +CGDIHGQ+YDL GG P ++Y+F Sbjct: 17 LPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVF 76 Query: 306 LGDYVDRGKQSLETICLLLAYKIKYPENXFLLRGNHECASINRIYGXYDECKRRY-NIKL 482 +GD+VDRG SLET LL K K+P+ LLRGNHE I ++YG YDEC+ +Y N Sbjct: 77 MGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANA 136 Query: 483 WKTFTDCFQL 512 W+ F L Sbjct: 137 WRYCCKVFDL 146 >SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (244), Expect = 2e-22 Identities = 46/76 (60%), Positives = 57/76 (75%) Frame = +3 Query: 108 PGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRXXEYGGFPP 287 PG VQL E +I+ +C SREIFL QP+LLE+ AP+ I GDIHGQY DLLR + G+PP Sbjct: 26 PGKQVQLPEAQIRQICQVSREIFLQQPMLLEIGAPINIFGDIHGQYEDLLRHFDKLGYPP 85 Query: 288 ESNYLFLGDYVDRGKQ 335 +Y+FLGDYVDR K+ Sbjct: 86 NESYIFLGDYVDRPKR 101 >SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) Length = 199 Score = 97.5 bits (232), Expect = 6e-21 Identities = 40/83 (48%), Positives = 60/83 (72%) Frame = +3 Query: 123 QLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRXXEYGGFPPESNYL 302 QLTE ++K LC K++EI + + E++ P+ +CGD+HGQ++DL+ GG P++NYL Sbjct: 23 QLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYL 82 Query: 303 FLGDYVDRGKQSLETICLLLAYK 371 F+GDYVDRG S+ET+ LL+ K Sbjct: 83 FMGDYVDRGYYSVETVTLLVTLK 105 >SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 92.7 bits (220), Expect = 2e-19 Identities = 44/90 (48%), Positives = 57/90 (63%) Frame = +3 Query: 171 IFLSQPILLELEAPLKICGDIHGQYYDLLRXXEYGGFPPESNYLFLGDYVDRGKQSLETI 350 I + +LE++AP+ +CGDIHGQ+YDL++ E GG P + YLFLGDYVDRG S+E Sbjct: 69 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIE-- 126 Query: 351 CLLLAYKIKYPENXFLLRGNHECASINRIY 440 CL Y FLLRGNHEC + + Sbjct: 127 CL-------YTNTLFLLRGNHECRHLTEYF 149 >SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) Length = 720 Score = 58.0 bits (134), Expect = 5e-09 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +3 Query: 150 LCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL----RXXEYGGFPPESNYLFLGDY 317 +C RE+ + +P +L +++P+ + GD+HG + DL+ G SN+LFLGDY Sbjct: 652 VCRSLREVVMEEPRMLRVQSPVYVLGDLHGNFRDLVCFEKLLWRMGPVLTPSNFLFLGDY 711 Query: 318 VDRGKQSLE 344 VDRG+ +E Sbjct: 712 VDRGENGVE 720 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 54.0 bits (124), Expect = 8e-08 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +3 Query: 276 GFP-PESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENXFLLRGNHE 416 G P PE+ Y+F GD VDRG +S+E +L A+ I YP ++ RGNHE Sbjct: 2 GLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHE 49 >SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) Length = 250 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = +3 Query: 219 ICGDIHGQYYDLLRXXEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENXFL 398 + GDIHG L + E +FLGDYVD +S TI L+ +I + Sbjct: 7 VFGDIHGGLRALQQLFERAEITINDKLIFLGDYVDGWSESAATIQFLI--EIAEKHDCIF 64 Query: 399 LRGNHE 416 ++GNH+ Sbjct: 65 IKGNHD 70 >SB_44697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +3 Query: 366 YKIKYPENXFLLRGNHECASINRIYGXYDECKRRYNIKLWKTFTDCFQLSSR 521 Y +Y E + +C ++R+ G + +RRY+++ +KT T ++ SR Sbjct: 90 YCTQYDETTGICPSGDDCPYLHRVAG---DVERRYHLRYYKTATCVYETDSR 138 >SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) Length = 493 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 321 DRGKQSLETICLLLAYKIKYPENXFLLRGNHECA 422 D KQS T+C+LL Y+ KY E + + N EC+ Sbjct: 444 DTTKQSRRTVCMLL-YRAKYIEGCY-ISVNTECS 475 >SB_35782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +2 Query: 2 TIFRTHTIYPMADRDTDELN-IDNVIKKLLKVRG---EQAWYECSVDGNRN 142 T F+ HT++P+ + EL+ ++ LK +G E+ W EC D N Sbjct: 906 TCFQPHTVHPLTNTTMQELHEHTRAVELRLKAQGYNYEEVW-ECQFDAQLN 955 >SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) Length = 1242 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 289 SPTISSLETMWTVASSPWKQYACSSPTRLNIPRIXFFYAETTS-VPASIGFMGXTMSAKG 465 S T S ++ V S+P+ SSP N P+I ++ T S VP+ + G M+ Sbjct: 69 SVTSSPVQPKPVVTSTPYSGSDLSSPDENNGPQITLPHSNTISGVPSHHSYPGSAMTPPH 128 Query: 466 GIT 474 G T Sbjct: 129 GHT 131 >SB_42892| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-06) Length = 812 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 278 LPSGVQLSLPWRLCGPWQAVLGNNMPAPRLQ 370 L S +++S+P+R+C + +LGN + A L+ Sbjct: 20 LKSSIRMSVPFRICLLFTFILGNPLKATSLE 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,550,970 Number of Sequences: 59808 Number of extensions: 327567 Number of successful extensions: 644 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -