BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0884 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0222 + 18858255-18858437,18858586-18858772,18858820-18859097 31 1.2 05_05_0019 - 21555727-21555777,21556252-21557213,21558242-21558308 29 4.7 06_01_1202 + 10389090-10389140,10389218-10389853,10390355-103904... 28 6.2 10_08_0234 - 16067579-16068157 28 8.2 07_03_1722 + 29036754-29036782,29036783-29037098 28 8.2 07_03_0200 - 15016084-15016342,15016814-15016869,15016963-150179... 28 8.2 >03_04_0222 + 18858255-18858437,18858586-18858772,18858820-18859097 Length = 215 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = -3 Query: 164 VGPNSNQLFGLIAELYSGPAFPYSESIFE*DCDLLFDCPGPECVWIPPA 18 +G +SN + L E + P E L CP P+ +W PA Sbjct: 10 IGSSSNSTYNLEGETPANQVIPVENYTMEGGIHPLLRCPAPQQIWSRPA 58 >05_05_0019 - 21555727-21555777,21556252-21557213,21558242-21558308 Length = 359 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 7/59 (11%) Frame = -3 Query: 275 DLRSAPASVQHSGQSYPNFVPIYVLCFGLIS-------QYFALSVGPNSNQLFGLIAEL 120 D++ P+S ++ G YPN P+Y + F S F+ S P S L G++ L Sbjct: 296 DMKPGPSSERNYGLFYPNGTPVYNIGFDAASFSPSPTTSTFSSSSRPTSTFLMGVVVLL 354 >06_01_1202 + 10389090-10389140,10389218-10389853,10390355-10390439, 10390536-10390654,10391251-10391318,10391401-10391710 Length = 422 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +2 Query: 59 IIDHNLTQRWTQNMERLDQSIAQRLGQTIDLNLAQRLGQSIERLDQNIVHRLGQNLDRID 238 IID ++ W ME+L ++I + G +I + + + +IE L +LDR D Sbjct: 187 IIDSESSETWLWFMEKLHEAIGEPAGLSICSDAGKGIDYAIEEELLEKSRGLNFDLDRSD 246 Query: 239 QSVVQ 253 + + Sbjct: 247 DFIAE 251 >10_08_0234 - 16067579-16068157 Length = 192 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 4 GSGVNAGGIQTHSGPGQSNNRSQSYSKMDSEYGKAGPEYSSA 129 G G AGG SG G + S ++ YG GP Y++A Sbjct: 121 GGGGQAGGNWGSSGSGDGSGAGSGSSSANTYYG--GPSYANA 160 >07_03_1722 + 29036754-29036782,29036783-29037098 Length = 114 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 225 WIGLTRVLYRGWG-RP*IKDWWVRM 296 W+G ++ R WG +KDWW R+ Sbjct: 22 WVGFHQLKPRRWGVAQSVKDWWERL 46 >07_03_0200 - 15016084-15016342,15016814-15016869,15016963-15017960, 15018707-15018768,15019242-15019274,15019697-15019881, 15020033-15020133,15020783-15020795,15021216-15021319, 15021593-15021693,15022773-15022849,15022965-15023021, 15023158-15023268,15023803-15023859 Length = 737 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 288 PTSL*STVCPSLCTTLWSILSKFCPNLCTMFWSNLSILCPKRWAKFK 148 P+SL TVC ++C + W C + ++ WS+ + K A ++ Sbjct: 223 PSSLGDTVCAAVCASTWVEPHGRCTVVFSLAWSSPKVKFKKGNAYYR 269 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,914,888 Number of Sequences: 37544 Number of extensions: 385685 Number of successful extensions: 1006 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -