BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0877 (570 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0983 - 23281787-23281931,23282045-23282163,23282765-232828... 27 8.0 >08_02_0983 - 23281787-23281931,23282045-23282163,23282765-23282871, 23284392-23284470,23285054-23285143,23285259-23285531, 23285617-23285769,23285969-23286290,23286428-23286672 Length = 510 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 325 QNRRNGKDAIFHPQQVHPLRLRRITQSHTAPE 230 + R G A+F Q + LRLRR+ Q+ AP+ Sbjct: 124 KERMIGPSALFFHQGEYHLRLRRLVQAALAPD 155 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,098,656 Number of Sequences: 37544 Number of extensions: 161222 Number of successful extensions: 290 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -