BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0875 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.13 |rba50||RNA polymerase II associated protein |Schizos... 29 0.68 SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 27 3.6 SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 26 4.8 SPAC7D4.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.4 >SPBC947.13 |rba50||RNA polymerase II associated protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 29.1 bits (62), Expect = 0.68 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 235 PRECIFLPPSHGSL-ERLHILSFPRLEVGQLGKHWLHPKDP 116 P + + L P+ S E+LH FP L V + WLH P Sbjct: 267 PEKQVTLDPNDPSFYEQLHDKYFPNLPVDEKQMQWLHDPSP 307 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 326 TSATPDTFIR*TSESTDPPP 267 T + P TF+R S STD PP Sbjct: 405 TPSKPSTFVRPHSSSTDSPP 424 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 556 KCQSIGHEFATELRSL 603 KCQS+ EF TELR L Sbjct: 962 KCQSMEREFKTELRKL 977 >SPAC7D4.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 551 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 180 ICRRSRDPWEGGRKIHSRGRYLPREIGYNWRRICGLRS 293 + R+S P+ G ++H + YNW I RS Sbjct: 417 LSRKSLPPYNGIHRLHESPSQFSNQSRYNWEPILENRS 454 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,182,732 Number of Sequences: 5004 Number of extensions: 68459 Number of successful extensions: 150 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -