BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0875 (730 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted ... 27 0.45 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 24 5.5 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 5.5 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 9.7 >DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted polypeptide protein. Length = 144 Score = 27.5 bits (58), Expect = 0.45 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 314 PDTFIR*TSESTDPPPVVANFTWQVTS 234 PD FI ++ S+ P P VA WQ S Sbjct: 61 PDKFIERSNSSSQPSPFVAFKVWQTKS 87 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 79 IHPGMKFSITGNGGLLGEASVFRADLPQVEEKTEYVDV 192 I PG + +T G L E A P+V+E+ + V + Sbjct: 686 IEPGSRALVTRRGDLTIEIGTGAAARPRVDERLDAVQL 723 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 79 IHPGMKFSITGNGGLLGEASVFRADLPQVEEKTEYVDV 192 I PG + +T G L E A P+V+E+ + V + Sbjct: 730 IEPGSRALVTRRGDLTIEIGTGAAARPRVDERLDAVQL 767 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 411 PLSD*AHFPPRTLNRLQYSNGEAVPVIALASQ 506 P + +H P T+ ++ GEA+PV +AS+ Sbjct: 851 PQAGGSHLPDLTVITPVFAPGEALPVFFVASR 882 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 9.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 513 VTIAKRALSQVLLHHSSTEGDLRFWVESELSLRVGEQQ 400 V+ A R + QVL EG + ++ S LSL + +QQ Sbjct: 583 VSTANRHMVQVLKQQLVLEGHDKQFLLSRLSLFIKQQQ 620 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,879 Number of Sequences: 2352 Number of extensions: 17565 Number of successful extensions: 30 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -