BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0875 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.0 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 509 VTVSLKHPPGATKAPSNANRSVMSLQP 589 ++VS+ PP A P N N + P Sbjct: 760 LSVSIPPPPSAQNVPQNTNSQAIPRIP 786 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 190 VPGTRGKAVEKYIHVDVTCHVKLATTGGGSVDSEVH 297 VPG G K V H A + GG++++ ++ Sbjct: 337 VPGDHGDHAPKQTEVRFKVHDPKAHSKGGTLENTIN 372 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 190 VPGTRGKAVEKYIHVDVTCHVKLATTGGGSVDSEVH 297 VPG G K V H A + GG++++ ++ Sbjct: 337 VPGDHGDHAPKQTEVRFKVHDPKAHSKGGTLENTIN 372 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,341 Number of Sequences: 438 Number of extensions: 5102 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -