BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0861 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 25 0.84 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 25 0.84 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 24 1.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.9 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 24.6 bits (51), Expect = 0.84 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +1 Query: 115 FFLQQSYSVTKLEIWIR*KPPITFLYF*YKSSHLNRNGLSESSN 246 FF+ +++ + + P+ F Y+ YK +H +S +SN Sbjct: 416 FFITDGEKAARMQAKVN-RQPVWFYYYTYKGAHSISEIMSGTSN 458 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 24.6 bits (51), Expect = 0.84 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +1 Query: 115 FFLQQSYSVTKLEIWIR*KPPITFLYF*YKSSHLNRNGLSESSN 246 FF+ +++ + + P+ F Y+ YK +H +S +SN Sbjct: 416 FFITDGEKAARMQAKVN-RQPVWFYYYTYKGAHSISEIMSGTSN 458 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 352 SQYINDRLLVCTKAFHGGPQ 293 S Y N L CT F GGPQ Sbjct: 6 SMYNNVSPLQCTSPFLGGPQ 25 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/23 (30%), Positives = 11/23 (47%) Frame = -3 Query: 387 CDMACRCMLDLVVNISMIACSSV 319 C C+C D N + + CS + Sbjct: 761 CPAGCKCYNDRTWNTNAVDCSGL 783 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,647 Number of Sequences: 438 Number of extensions: 4288 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -