BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0857 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 25 0.91 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 23 3.7 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 24.6 bits (51), Expect = 0.91 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 109 TQNRIQQNEAHPIFILKVFKTFRNPRY 29 ++ RI EA F++K+FKTF++ +Y Sbjct: 415 SEKRIM-GEADCDFVVKLFKTFKDRKY 440 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 355 ELESLFQKTHYPDVFLREEVALRISLSEARVQV 453 ELE F HY R E+A + L+E ++++ Sbjct: 22 ELEKEFHYNHYLTRRRRIEIAHALCLTERQIKI 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,929 Number of Sequences: 438 Number of extensions: 3298 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -