BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0852 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0485 - 8808139-8808618 39 0.005 03_02_0484 + 8805053-8805538 39 0.005 03_02_0483 - 8804021-8804485 39 0.005 03_02_0478 + 8775892-8776377 37 0.015 02_02_0077 - 6586638-6587165 37 0.015 04_04_0017 + 22176759-22177406 36 0.026 01_01_0230 - 1946079-1946786,1946981-1947141,1948010-1948457 36 0.045 01_01_0229 - 1943473-1943922 35 0.059 01_01_0231 + 1951047-1951499 35 0.078 12_01_0061 + 514798-515967 34 0.14 11_02_0041 - 7669692-7670312 34 0.14 02_05_0494 + 29486960-29487454 33 0.18 01_01_0227 + 1933247-1933699 33 0.31 03_05_0865 - 28365430-28367640 31 0.73 01_01_0599 - 4448290-4448790 31 0.73 02_05_0308 - 27754340-27754634,27755591-27755696,27755781-277558... 30 1.7 01_05_0523 - 22915390-22915901,22916496-22916619,22916708-229168... 30 1.7 02_05_0444 - 29073740-29073844,29074417-29074725,29077910-290779... 30 2.2 12_02_0643 - 21461123-21461902 29 2.9 01_01_0228 + 1940149-1940649 29 5.1 11_01_0319 - 2396835-2396951,2397035-2397105,2397219-2397297,239... 28 6.8 07_03_0725 + 20991640-20992471,20993308-20993418,20993542-209937... 28 6.8 03_04_0159 + 17832666-17832938,17833634-17833873 28 6.8 03_02_0467 + 8707777-8707892,8708030-8708096,8708190-8708260,870... 28 6.8 01_06_0381 + 28878811-28879120,28880189-28880331,28880753-288815... 28 6.8 07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637 28 9.0 01_01_0277 + 2274383-2274465,2274889-2274955,2275040-2275110,227... 28 9.0 >03_02_0485 - 8808139-8808618 Length = 159 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVP 492 S +F+RR+ LPE PE +++ + +GVLT+T P++ P Sbjct: 111 SGKFLRRFRLPENTKPEQIKASM-ENGVLTVTVPKEEP 147 >03_02_0484 + 8805053-8805538 Length = 161 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVP 492 S +F+RR+ LPE PE +++ + +GVLT+T P++ P Sbjct: 113 SGKFLRRFRLPENTKPEQIKASM-ENGVLTVTVPKEEP 149 >03_02_0483 - 8804021-8804485 Length = 154 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVP 492 S +F+RR+ LPE PE +++ + +GVLT+T P++ P Sbjct: 106 SGKFLRRFRLPENTKPEQIKASM-ENGVLTVTVPKEEP 142 >03_02_0478 + 8775892-8776377 Length = 161 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/36 (41%), Positives = 27/36 (75%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPRK 486 S +F+RR+ LP+ A PE +++ + +GVLT+T P++ Sbjct: 113 SGKFLRRFRLPDNAKPEQIKASM-ENGVLTVTVPKE 147 >02_02_0077 - 6586638-6587165 Length = 175 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/51 (39%), Positives = 28/51 (54%) Frame = +1 Query: 385 QFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVPDAVKGERKVPIAQTG 537 +F+RR+ LPE A + V + DGVLT+T +K P K R V + G Sbjct: 117 KFMRRFPLPESADLDGVRAEYK-DGVLTVTVDKKPPPEPKKPRVVEVKVAG 166 >04_04_0017 + 22176759-22177406 Length = 215 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = +1 Query: 385 QFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVPDAVKGERKVPIAQTG 537 +F R+ LP+ A +++ + L + GVLT+ + PD +KG R V IA G Sbjct: 141 RFWRQLRLPDNADLDSIAASLDN-GVLTVRFRKLAPDQIKGPRVVGIASAG 190 >01_01_0230 - 1946079-1946786,1946981-1947141,1948010-1948457 Length = 438 Score = 35.5 bits (78), Expect = 0.045 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPR 483 S QF+RR+ LPE A + V++ L +GVLT+T P+ Sbjct: 102 SGQFMRRFRLPENAKVDQVKAGL-ENGVLTVTVPK 135 >01_01_0229 - 1943473-1943922 Length = 149 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPR 483 S QF+RR+ LPE A + V++ + +GVLT+T P+ Sbjct: 101 SGQFMRRFRLPENAKVDQVKASM-ENGVLTVTVPK 134 >01_01_0231 + 1951047-1951499 Length = 150 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPR 483 S QF+RR+ LPE A + V++ + +GVLT+T P+ Sbjct: 102 SGQFMRRFRLPENAKVDQVKAGM-ENGVLTVTVPK 135 >12_01_0061 + 514798-515967 Length = 389 Score = 33.9 bits (74), Expect = 0.14 Identities = 22/51 (43%), Positives = 26/51 (50%) Frame = -2 Query: 581 SWVPSLWSLISLRTGPVCAMGTFLSPLTASGTFLGAVMVRTPSDDSRDSTV 429 SW PS +LISL +G CA F S + A+ FL SDD D TV Sbjct: 295 SWSPSKLNLISLGSGRFCAAKIFRSNMPAAAAFL------DDSDDDDDYTV 339 >11_02_0041 - 7669692-7670312 Length = 206 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +1 Query: 385 QFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVP 492 +F RR+ +P GA V +RL DGVLT+T P KVP Sbjct: 141 RFWRRFRMPPGADVGRVAARLD-DGVLTVTVP-KVP 174 >02_05_0494 + 29486960-29487454 Length = 164 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +1 Query: 382 RQFVRRYALPEGAAPETVESRLSSDGVLTITAPRK 486 R V ++ LPE AA + +R++ DGVLT+T P++ Sbjct: 106 RAAVTQFRLPEDAAADEASARMA-DGVLTVTVPKR 139 >01_01_0227 + 1933247-1933699 Length = 150 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 379 SRQFVRRYALPEGAAPETVESRLSSDGVLTITAPRK 486 S +F RR+ LP GA + V + + +GVLT+T P++ Sbjct: 102 SGKFQRRFRLPRGARVDQVSASM-DNGVLTVTVPKE 136 >03_05_0865 - 28365430-28367640 Length = 736 Score = 31.5 bits (68), Expect = 0.73 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 483 EGTRRRQGREKGAHRTDRSRSQGDQGPERGN 575 + +RR + RE+G DR R +GD+ ERG+ Sbjct: 114 DSSRRDRDRERGDRDRDRDRERGDRDRERGD 144 >01_01_0599 - 4448290-4448790 Length = 166 Score = 31.5 bits (68), Expect = 0.73 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 385 QFVRRYALPEGAAPETVESRLSSDGVLTITAPRKVPDAVKGERKVPI 525 +F+R++ LP+ A + + S + DGVLT+T + P K + + + Sbjct: 118 KFMRKFVLPDNADVDKI-SAVCQDGVLTVTVEKLPPPEPKKPKTIEV 163 >02_05_0308 - 27754340-27754634,27755591-27755696,27755781-27755855, 27756039-27757410 Length = 615 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -2 Query: 314 VFTEISSGEKCCTSRLTWNLSLSAFMLEPRSRD 216 +F ++S GE+C ++ T+N+ +SA + R+ D Sbjct: 401 LFEKMSKGEECLPNQDTYNIIISAMFMRKRAED 433 >01_05_0523 - 22915390-22915901,22916496-22916619,22916708-22916844, 22917383-22917518,22917614-22917951,22919426-22919663 Length = 494 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 474 RAEEGTRRRQGREKGAHRTDRSRSQGDQGPERG 572 R EEG RRR+G+ KGA + + D P G Sbjct: 8 REEEGRRRRKGKGKGAGEMVLQQEEEDAAPAMG 40 >02_05_0444 - 29073740-29073844,29074417-29074725,29077910-29077981, 29078541-29078633,29078825-29078982,29079247-29079415, 29080204-29081241,29081632-29081759,29081926-29081985, 29082033-29083077 Length = 1058 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 504 GREKGAHRTDRSRSQGDQGPERGNPGC 584 GR R R + QG++G ERG GC Sbjct: 73 GRTTTTRRRRRRKQQGEEGEERGERGC 99 >12_02_0643 - 21461123-21461902 Length = 259 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 464 SPSPRRGRYPTPSRERERCPSHRPVPF 544 SPSP RGR TP R R P+ P P+ Sbjct: 211 SPSPLRGRPRTPPPPRPRPPTTPPRPY 237 >01_01_0228 + 1940149-1940649 Length = 166 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 388 FVRRYALPEGAAPETVESRLSSDGVLTITAPRKVPDAVKGER 513 +V R LP G E V + VL IT R V KG+R Sbjct: 52 YVFRADLPAGVKKEEVRVEVDEGNVLVITGERSVRREEKGQR 93 >11_01_0319 - 2396835-2396951,2397035-2397105,2397219-2397297, 2397417-2397458,2397670-2397723,2397836-2397868, 2397959-2398039,2398144-2398230,2398313-2398388, 2398633-2398808,2398912-2399034,2399249-2399361, 2399521-2399632,2400054-2400273,2401986-2402314, 2402408-2402713,2403580-2403878,2404079-2404181, 2404266-2404369,2404840-2404906,2404911-2405076, 2405241-2405956 Length = 1157 Score = 28.3 bits (60), Expect = 6.8 Identities = 19/62 (30%), Positives = 28/62 (45%) Frame = +2 Query: 347 TKRRKTSTGIFQGSSSDVTRCLKARRLRLWNRGCHQTGFSPSPRRGRYPTPSRERERCPS 526 ++RR+ + G TR + RR + C +G RR R+ SR R+R S Sbjct: 12 SRRRRRDSDDESGERDLDTR--RHRRRSPSSESCSSSGDDDRSRRHRHDESSRRRQRDQS 69 Query: 527 HR 532 HR Sbjct: 70 HR 71 >07_03_0725 + 20991640-20992471,20993308-20993418,20993542-20993739, 20993860-20993891,20993943-20994153,20994806-20995043, 20995507-20995657,20996171-20996533 Length = 711 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +1 Query: 109 DQDFGLALTPNDMLAAVACPVLSEDYFRPWRQLAAASRD 225 D+ FGLAL DM A AC F+ R L RD Sbjct: 75 DRVFGLALCRGDMRDAAACAGCVSGAFQRLRALCGRDRD 113 >03_04_0159 + 17832666-17832938,17833634-17833873 Length = 170 Score = 28.3 bits (60), Expect = 6.8 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +3 Query: 459 GSHHHRAEEGTRRRQGREKGAHRTDRSRSQ-----GDQGPER 569 G H R R R+GR +G R RS + GDQGP R Sbjct: 7 GKHPKRGRGRPRGRRGRGRGRGRGGRSLASPAAGPGDQGPRR 48 >03_02_0467 + 8707777-8707892,8708030-8708096,8708190-8708260, 8708629-8708746,8708820-8708893,8709278-8709333, 8709448-8709531,8709611-8709698,8709786-8709863, 8710335-8710391,8710606-8711044 Length = 415 Score = 28.3 bits (60), Expect = 6.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 395 DVTRCLKARRLRLWNRGCHQTGFSPSPRR 481 + + + A R+RLWN+G F P R+ Sbjct: 189 ETAKVVSANRVRLWNKGVDSESFHPKFRK 217 >01_06_0381 + 28878811-28879120,28880189-28880331,28880753-28881532, 28882568-28883968 Length = 877 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 453 RRGSHHHRAEEGTRRRQGREKGAHRTDRSRSQ 548 R+GS+H + E +++R K A DRS ++ Sbjct: 448 RKGSNHGKGESKSKKRSSTSKDASSPDRSSAE 479 >07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637 Length = 309 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 407 CLKARRLRLWNRGCHQTGFSPSPRRGRYPTPSR 505 C K R W R C + R GRY PSR Sbjct: 128 CFKCGRAGHWARECPYSSGGGGGRTGRYSPPSR 160 >01_01_0277 + 2274383-2274465,2274889-2274955,2275040-2275110, 2275550-2275667,2275755-2275828,2276094-2276149, 2276237-2276320,2276422-2276509,2276602-2276679, 2276814-2276870,2277074-2277578 Length = 426 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 395 DVTRCLKARRLRLWNRGCHQTGFSPSPR 478 + + A R+RLWN+G F P R Sbjct: 178 ETAHVISANRIRLWNKGVDSASFHPKFR 205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,485,250 Number of Sequences: 37544 Number of extensions: 425006 Number of successful extensions: 1727 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -