BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0851 (612 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373... 30 1.3 05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581 29 2.2 03_05_0183 - 21681673-21682524 29 2.9 01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157... 29 2.9 07_03_1086 + 23858419-23859423,23859527-23859610 29 3.8 07_03_0626 + 20060013-20060273,20061017-20061274 27 8.9 02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-56... 27 8.9 >06_03_1055 - 27234824-27234838,27236087-27236125,27236322-27237388, 27237422-27237630,27237650-27238053 Length = 577 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 455 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPF 583 A+ A +GK + E E S+QCD T + +S RE ++R+P+ Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPY 471 >05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581 Length = 311 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 368 GHLVHALGR-AAGGAKLPSAGLCLNASKAEASLA 466 G LV L R GG SAG+C S+ +ASLA Sbjct: 203 GRLVETLARDGGGGGGAYSAGVCFYGSRMDASLA 236 >03_05_0183 - 21681673-21682524 Length = 283 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 156 SQAFIATLLFDPSMSALPIIAKQNSPS 236 SQAF A LL D + +A+P++ Q P+ Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPA 255 >01_07_0197 + 41912207-41912652,41913226-41913800,41913828-41915748, 41915836-41916049,41916143-41916394,41916469-41916528, 41916646-41916776,41916898-41917012,41917084-41917239 Length = 1289 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 95 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SFDVG 202 YK F A G RKV GIT + PS+ D+AF S +G Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALG 669 >07_03_1086 + 23858419-23859423,23859527-23859610 Length = 362 Score = 28.7 bits (61), Expect = 3.8 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 5/76 (6%) Frame = +2 Query: 308 LLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNA-----SKAEASLAES 472 LL CD N A + LVHAL AA A +A L A AS+ + Sbjct: 129 LLNLSICDENKAIIVEAGAIRPLVHALKSAASPAARENAACALLRLSQLDGSAAASIGRA 188 Query: 473 GKDMLTVEPRESGGSK 520 G L V E+GG++ Sbjct: 189 GAIPLLVSLLETGGAR 204 >07_03_0626 + 20060013-20060273,20061017-20061274 Length = 172 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 467 RLGWLRP*RRSGIIP 423 RLGWLRP R S ++P Sbjct: 32 RLGWLRPSRLSAVVP 46 >02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-568298, 568420-568489 Length = 540 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 474 ARICSLWSPESREALNNVTLLVAFRIQNARRDVEA 578 AR C W PESR ++ V ++A ++R+ A Sbjct: 449 ARECLQWEPESRPTMSEVVQILATIAPSSRKHAAA 483 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,434,578 Number of Sequences: 37544 Number of extensions: 342407 Number of successful extensions: 867 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -