BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0848 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.13 |||glutamyl-tRNA amidotransferase|Schizosaccharomyces... 29 0.48 SPAC3G6.06c |rad2|fen1|FEN-1 endonuclease|Schizosaccharomyces po... 29 0.48 SPBC17D1.05 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 4.5 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 26 6.0 >SPAC343.13 |||glutamyl-tRNA amidotransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 29.5 bits (63), Expect = 0.48 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -1 Query: 235 LQCDRSKLNSGMTISRILLRCVLKPSRSLTIVTKAWFYSTNTISS 101 L+ D +K S SRILL + L IVTK F+ NT+S+ Sbjct: 129 LEQDTAKSTSAKNPSRILLDYNRAGTPLLEIVTKPCFHDVNTVSA 173 >SPAC3G6.06c |rad2|fen1|FEN-1 endonuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 29.5 bits (63), Expect = 0.48 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = +2 Query: 5 STASYQPSYQISTQNYQPATNSHGDASSINVGAGYSI-----GGIKPSFSYDGQ 151 S + YQ Q+ +Q+ Q N G+ +S +G Y GIKP F +DG+ Sbjct: 36 SMSLYQFLIQVRSQDGQQLMNEQGETTSHLMGMFYRTLRIVDNGIKPCFVFDGK 89 >SPBC17D1.05 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 368 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 446 LGGSPAHYASGVKGLSSYGST 508 LG SPA ASG+ G S +GS+ Sbjct: 109 LGTSPAEPASGLVGSSGFGSS 129 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 83 SSINVGAGYSIGGIKPSFSYDGQGSAGLQYASQEYPANGHA 205 ++ N G +S G S + QG+ G + S PA +A Sbjct: 121 NNANTGTSFSFGSNAGSTGFGSQGTGGGLFGSSTTPATTNA 161 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,684,881 Number of Sequences: 5004 Number of extensions: 50880 Number of successful extensions: 159 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -