BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0848 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 2.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.7 DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 pr... 21 8.5 AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-ri... 21 8.5 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 21 8.5 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +2 Query: 266 GDISQIMNQLSHSLNSG--ALSLQPSN 340 GD+ I ++LSH + SG A+ L P N Sbjct: 47 GDLKGIKDKLSHFIESGITAIWLSPIN 73 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 155 SAGLQYASQEYPANGHATIQLAPITLQPTHGAGGLVSGDIS 277 S +Q+ + +P NGH+ P+ PT+ + SG S Sbjct: 1740 SKAMQFQTFPHPGNGHSGTMGPPVG-HPTNASAHSRSGSQS 1779 >DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 precursor protein. Length = 223 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 3 TLQQAISHHIKSVHK 47 TLQ AIS H+K V + Sbjct: 87 TLQSAISAHMKKVRE 101 >AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-rich protein precursor protein. Length = 223 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 3 TLQQAISHHIKSVHK 47 TLQ AIS H+K V + Sbjct: 87 TLQSAISAHMKKVRE 101 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 3 TLQQAISHHIKSVHK 47 TLQ AIS H+K V + Sbjct: 87 TLQSAISAHMKKVRE 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,237 Number of Sequences: 438 Number of extensions: 3872 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -