BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0845 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45596| Best HMM Match : rve (HMM E-Value=1.8e-07) 38 0.011 SB_20018| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) 34 0.11 SB_385| Best HMM Match : SRP54_N (HMM E-Value=1.1) 34 0.11 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 34 0.11 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 32 0.57 SB_2013| Best HMM Match : Lipase_GDSL (HMM E-Value=2.7) 32 0.57 SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) 31 0.76 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 31 0.76 SB_39590| Best HMM Match : PHD (HMM E-Value=2.2e-18) 31 1.00 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 31 1.3 SB_19190| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 31 1.3 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 31 1.3 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_53775| Best HMM Match : Involucrin2 (HMM E-Value=7.1e-12) 30 1.7 SB_43866| Best HMM Match : Gelsolin (HMM E-Value=0.092) 30 1.7 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 30 1.7 SB_1116| Best HMM Match : THAP (HMM E-Value=0.00013) 30 1.7 SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 30 1.7 SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) 30 1.7 SB_35298| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 30 1.7 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 30 2.3 SB_12442| Best HMM Match : zf-MYND (HMM E-Value=0.0028) 30 2.3 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 30 2.3 SB_1562| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_29614| Best HMM Match : Flavodoxin_1 (HMM E-Value=0.22) 29 3.0 SB_17867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_7993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 29 3.0 SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_31610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 4.0 SB_59462| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47950| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_29636| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_56336| Best HMM Match : Ag332 (HMM E-Value=5.1) 29 5.3 SB_48649| Best HMM Match : DUF809 (HMM E-Value=1.3) 29 5.3 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_39219| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_21440| Best HMM Match : RNA_pol_A_bac (HMM E-Value=0.0073) 29 5.3 SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_5458| Best HMM Match : E-MAP-115 (HMM E-Value=0.3) 29 5.3 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) 29 5.3 SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) 29 5.3 SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_3121| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_1343| Best HMM Match : IBB (HMM E-Value=2.3) 29 5.3 SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_39173| Best HMM Match : DUF689 (HMM E-Value=3.1) 28 7.0 SB_35042| Best HMM Match : S-antigen (HMM E-Value=3) 28 7.0 SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_58197| Best HMM Match : Ribosomal_L5_C (HMM E-Value=3) 28 7.0 SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) 28 7.0 SB_47763| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 28 7.0 SB_25538| Best HMM Match : Kinesin (HMM E-Value=0) 28 7.0 SB_24403| Best HMM Match : BRF1 (HMM E-Value=1.2) 28 7.0 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_58524| Best HMM Match : Ank (HMM E-Value=3.4e-16) 28 9.3 SB_54260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) 28 9.3 SB_43371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 28 9.3 SB_30182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 28 9.3 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 9.3 SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) 28 9.3 SB_12456| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56330| Best HMM Match : PP1_inhibitor (HMM E-Value=8.4) 28 9.3 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52889| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) 28 9.3 SB_43079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30526| Best HMM Match : LRR_1 (HMM E-Value=8e-08) 28 9.3 SB_26014| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) 28 9.3 SB_24802| Best HMM Match : Phage_fiber_C (HMM E-Value=1.1) 28 9.3 SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) 28 9.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 28 9.3 SB_5528| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_45596| Best HMM Match : rve (HMM E-Value=1.8e-07) Length = 882 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +3 Query: 564 AKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQNQTSDITAQSSS 728 A EK R + +++ ++ NVI+ LK +E MEA+ S GS+ I Q+S+ Sbjct: 272 ALEKNRPRLKIRQKRLDMQRNVIQANLKAEEAEMEALLSQGSRRSIPGIGRQTST 326 >SB_20018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 36.3 bits (80), Expect = 0.027 Identities = 34/158 (21%), Positives = 66/158 (41%), Gaps = 11/158 (6%) Frame = +3 Query: 309 NKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKRE-EDLWAKFLEGTDS-KPKPVLK 482 ++V ++ + T+ ++ + E EKK EDLWA F + T++ +PK + Sbjct: 61 DEVDDDDNDDDEVDLDATTAEELAKKKKEKEEAEKKTHVEDLWASFKKETEAVRPKSTVA 120 Query: 483 EKSVDLVTNPER----SSNNTVNYKKTNDDDAKEKE--RRIFEFAGEKIVVENNVIKERL 644 L + E+ S + + K + +K + ++FAGE + V V E Sbjct: 121 SSGSKLTKSTEKLQRQSPSVAASTKPAAQSTSAQKVTITKTYDFAGEAVTVTKTVDAESS 180 Query: 645 KVDE---TSMEAIKSDGSQNQTSDITAQSSSSANPGGL 749 + + + E G ++ A+ S ++ GGL Sbjct: 181 EAKQQYKSEKEVTTPAGLAGLSAPAPAKKSDPSSMGGL 218 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 161 SGSESDEDYVPGEPEKLSEEESADDETE 244 S E DEDYVPG E S++E +D E Sbjct: 7 SSDEEDEDYVPG-VESASDDEGLEDIDE 33 >SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) Length = 397 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 4/83 (4%) Frame = +3 Query: 348 IIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKP--VLKEKSVDLVTNPERS 521 + +V S+ D+TP P+ S+Q KK+E+ +A ++ T K K V KE +T E Sbjct: 163 VFEVPSQTDETPTPV--SQQVKKKEKLQFASKIKKTHEKKKEKNVAKESHKQTLTEEEHG 220 Query: 522 S--NNTVNYKKTNDDDAKEKERR 584 S + + K+ + KE + R Sbjct: 221 SIIQDKLQRKEIKYEKLKEGKSR 243 >SB_385| Best HMM Match : SRP54_N (HMM E-Value=1.1) Length = 210 Score = 34.3 bits (75), Expect = 0.11 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 4/113 (3%) Frame = +3 Query: 312 KVKKSRKSQNDTIIQVTSEKDKTP---EPIVDSEQEKKREEDLWAKFLEGTDS-KPKPVL 479 K KK +S+ + + S K KTP E +S++ K+ + + K G + K P Sbjct: 67 KKKKKAESKPKSAEKSKSSKSKTPAKKETKKESKKSPKKSKPVTVKITSGKKTPKKSPKK 126 Query: 480 KEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKE 638 K+VD +++ E + + +DD + + + A K+V ++ KE Sbjct: 127 AHKTVDDLSSDEEPLVKKLKKQPPTNDDLVTVVKDLLKDADLKVVTVKSICKE 179 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVT-SEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPV 476 E++ K + K + + + + EKD+ + E+++K+EE++ AK E + K Sbjct: 353 ERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREEKK- 411 Query: 477 LKEKSVDLVTNPERSSNNTVNY 542 K++ + + E++ NN VN+ Sbjct: 412 -KQEEEEKMKKKEQAKNNFVNF 432 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 32.3 bits (70), Expect = 0.43 Identities = 31/111 (27%), Positives = 45/111 (40%), Gaps = 3/111 (2%) Frame = +3 Query: 360 TSEKDKTPEPIVDSEQ---EKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNN 530 T +K K E + EQ E+K+ E+ K E +SK K EK + E Sbjct: 1029 TFDKTKEGEKKMKDEQDEIERKKAEEEEKKRKEEEESKKKD---EKEKEEEDEDEEEEEE 1085 Query: 531 TVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSD 683 KT+D + KE E E E E +E DET+ E+ + + Sbjct: 1086 KKEDAKTDDSETKEAEPESKEAEPESKEAEPESKEETKSEDETTEESSRDE 1136 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/92 (21%), Positives = 45/92 (48%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 +K + +K RK + ++ + EK+K E + E+E+K+E+ AK + + +P Sbjct: 1050 KKAEEEEKKRKEEEES--KKKDEKEKEEEDEDEEEEEEKKED---AKTDDSETKEAEPES 1104 Query: 480 KEKSVDLVTNPERSSNNTVNYKKTNDDDAKEK 575 KE + S T + +T ++ ++++ Sbjct: 1105 KEAEPESKEAEPESKEETKSEDETTEESSRDE 1136 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 31.9 bits (69), Expect = 0.57 Identities = 27/109 (24%), Positives = 43/109 (39%), Gaps = 1/109 (0%) Frame = +3 Query: 312 KVKKSRKSQNDTIIQVTSEKDKTPEP-IVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEK 488 K KK +K + I + D+ EP I++ ++ K+E+ L A + + PV+K Sbjct: 210 KSKKGKKGKKTDIADLAVAGDELAEPSILEPQKASKKEKSLDADGVGDDEEDDGPVIKTA 269 Query: 489 SVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIK 635 + ER K+ A K+ E G EN V K Sbjct: 270 AQKKAEKKEREKKKKAQEKERQKAKAAAKKEEKPEQEG-NTEAENEVKK 317 >SB_2013| Best HMM Match : Lipase_GDSL (HMM E-Value=2.7) Length = 518 Score = 31.9 bits (69), Expect = 0.57 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 438 KFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVNYKK 548 +F P+P+L + ++++TNP+ S++ T NYK+ Sbjct: 328 QFTTAVPRLPEPLLLDNPLEIITNPKCSTSVTPNYKQ 364 >SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) Length = 976 Score = 31.5 bits (68), Expect = 0.76 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 4/89 (4%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTI---IQVTSEKDKTP-EPIVDSEQEKKREEDLWAKFLEGTDSKP 467 E++ K Q T+ IQ K+K P E D E +KK + K +G+D K Sbjct: 87 EEVQKTIIDEDGQEKTVTVTIQKKVIKEKDPSEKKKDGESKKKHRSE---KAKDGSDGKE 143 Query: 468 KPVLKEKSVDLVTNPERSSNNTVNYKKTN 554 + KEK D T ++ + ++ KK++ Sbjct: 144 RSDRKEKRKDRKTKSDKDGDEGMSGKKSD 172 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 31.5 bits (68), Expect = 0.76 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 2/129 (1%) Frame = +3 Query: 303 KINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEK--KREEDLWAKFLEGTDSKPKPV 476 K N + + + T IQ + K E IV Q++ R +D W + ++G S+ + + Sbjct: 1270 KDNALLQKDNTDKSTEIQNMELEIKRLENIVSDLQKELENRPDDDWKEEVDGLKSRNEEL 1329 Query: 477 LKEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDE 656 LKE V+ + N K+ D EKE I E EK+ N ++ + +V+ Sbjct: 1330 LKE--VESLKE---------NLKEIKDGSQTEKENLIEEKEREKLNAMNELLNAKAEVEV 1378 Query: 657 TSMEAIKSD 683 E + ++ Sbjct: 1379 KLQEQLTAN 1387 >SB_39590| Best HMM Match : PHD (HMM E-Value=2.2e-18) Length = 1284 Score = 31.1 bits (67), Expect = 1.00 Identities = 23/112 (20%), Positives = 48/112 (42%), Gaps = 2/112 (1%) Frame = +3 Query: 360 TSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKP--VLKEKSVDLVTNPERSSNNT 533 + + ++ P +E+ + +ED W SKPK V K V+ ++ + SN Sbjct: 547 SGQNSESSSPESSNEESSENDEDEWKPEPSNKQSKPKRKYVRKSAPVESDSSDDEDSNKP 606 Query: 534 VNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGS 689 + + ++ EK K+ ++N IK++L + IK++ + Sbjct: 607 LAVLQQEIKESPEKVVTKVIRVMRKVKLKNGEIKKKLVKVIRKVRTIKTEAA 658 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.3 Identities = 36/148 (24%), Positives = 57/148 (38%), Gaps = 4/148 (2%) Frame = +3 Query: 312 KVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKS 491 + ++SR Q I T E +KT E EQEK+ + K ++S+ KP K Sbjct: 971 QARRSRSRQRKVITPDTEEPEKTFETETQREQEKQHVD----KGKTPSESESKPTTKAAK 1026 Query: 492 V-DLVTNPE---RSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDET 659 V P+ SS Y DD+ KE + +++V N + + T Sbjct: 1027 VKSKHEKPKFVIESSLGKDFYSSKKPDDSSSKENIHDDIPKPEVIVIQNKTFDDTNI--T 1084 Query: 660 SMEAIKSDGSQNQTSDITAQSSSSANPG 743 + A +G Q S S++ G Sbjct: 1085 TKPAPVKEGKTKQESAAFEDVELSSHKG 1112 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 30.7 bits (66), Expect = 1.3 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 2/141 (1%) Frame = +3 Query: 318 KKSRKSQNDTIIQVTSEKDKT-PEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSV 494 +K K + + EK++ E + ++EK R++ K + K K V KEK Sbjct: 960 EKEEKEKQKEAERAKKEKERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKDKQVEKEK-- 1017 Query: 495 DLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKE-RLKVDETSMEA 671 + S V +K +D + K KE+ E KI E N + E +L V+ET+ E Sbjct: 1018 -------KDSLKRVKKRKDSDKERKVKEKE--EEQKVKIEKEPNKVTEVQLMVEETNKEE 1068 Query: 672 IKSDGSQNQTSDITAQSSSSA 734 S ++ S++ S SA Sbjct: 1069 SPST-DRDAESELPKAGSVSA 1088 >SB_19190| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1829 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 564 AKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGS 689 A +++R + +++ ++ NVI+ LK +E MEA+ S GS Sbjct: 544 ALQEDRLRLKTRQKRLDMQRNVIQAELKAEEAEMEALLSQGS 585 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +3 Query: 402 EQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKER 581 E++K+++ED + +GTD K + ++E + DL S+NT + KEK++ Sbjct: 1533 EKKKRKKEDEATRSDDGTDEKTEDSMQEDAKDL------DSSNTASDTTKEKGKNKEKDK 1586 Query: 582 RIFE 593 + E Sbjct: 1587 TVLE 1590 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/129 (18%), Positives = 56/129 (43%), Gaps = 1/129 (0%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKR-EEDLWAKFLEGTDSKPKPV 476 + + V +S++ + + ++D+ +V++ E K +E L+ E K + Sbjct: 1027 DALENVYQSKEKLQHRLDEALCKQDQYKNSLVEAVDEAKTLKESLYRMVNEHETMKESLL 1086 Query: 477 LKEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDE 656 + + + + N + K+ +D+ ++E + V E N +KER++ Sbjct: 1087 NANREIGRLKCENTAKNLDADRKEDQEDEEVQREGENNKDNTAADVAETNALKERVQNLL 1146 Query: 657 TSMEAIKSD 683 ++E KSD Sbjct: 1147 EAVETAKSD 1155 Score = 29.9 bits (64), Expect = 2.3 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 3/114 (2%) Frame = +3 Query: 396 DSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVNYKKTNDDDAKEK 575 D + ++ + K ++ +S+ K LKE+ DL ++ N +N +K +D KEK Sbjct: 2995 DELHKTSKDRVIDEKTIKDKESENK-TLKEEEQDLKRRLRQADNVQLNLRKDLEDLQKEK 3053 Query: 576 ERRIFEFAGEKIVVENNVIKERLKVDETSME-AIKSDGSQ--NQTSDITAQSSS 728 E E E + I E++KV TS E A+ S SQ + S+ A++SS Sbjct: 3054 EELRKE--NENLKKRKLSIVEKVKV--TSSECAVASQVSQVPDLGSEPVAKASS 3103 >SB_53775| Best HMM Match : Involucrin2 (HMM E-Value=7.1e-12) Length = 1879 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +3 Query: 315 VKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 V++ + SQ + I+ + ++ EPI+ EQ++ +E+ A +E + KP L Sbjct: 1668 VEQQQTSQEEPILSMKQQQTSQEEPILSMEQQRTSQEEP-ALSMEQQQTSKKPTL 1721 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/89 (24%), Positives = 44/89 (49%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 E I +K+ + SQ + I+ + + EPI+ EQ++K E L + + SK +P L Sbjct: 1732 EPILSMKQQQTSQEEPILSMEQHQTSQEEPILSMEQQQK-ESGLCVE--QQQTSKEEPAL 1788 Query: 480 KEKSVDLVTNPERSSNNTVNYKKTNDDDA 566 V+ + S +V ++T+ +++ Sbjct: 1789 ---GVEQQLTSKEESAPSVEQQQTSKEES 1814 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 E V++ + SQ + + V ++ EPI+ EQ++ +E+ A +E + KP L Sbjct: 1553 ETTANVEQRQTSQGQSALSVEQQQTSQEEPILSIEQQQTSQEEP-ALSMEQQQTSKKPTL 1611 >SB_43866| Best HMM Match : Gelsolin (HMM E-Value=0.092) Length = 341 Score = 30.3 bits (65), Expect = 1.7 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 3/98 (3%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 +K +V+KS + + + T E K E +EQ+K+ EE + EG +P+L Sbjct: 124 DKDGEVEKSEEKPKEAKAE-TEESGKIEEVETTTEQDKQPEEVVKNSEEEGNHEDQEPLL 182 Query: 480 --KEKSVDLVTNPERSSNNTVNYKKTNDDDAK-EKERR 584 ++ D T P + K T + A+ E+E++ Sbjct: 183 SFEDTHEDPETKPVEGEEPALYQKVTEEPSAEIEQEKK 220 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 30.3 bits (65), Expect = 1.7 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 3/132 (2%) Frame = +3 Query: 342 DTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERS 521 DT+ Q T EK IV + EDL D+K K++ ++ V S Sbjct: 255 DTLSQATVEKQALVREIVATSLR----EDLQILL----DNKKNR--KKERIENVIESATS 304 Query: 522 SNNTVNYKKTNDDDAKEKERRIFEFAGEKIVV--ENNVIKERLKVDETSM-EAIKSDGSQ 692 NN + K + D K F +++ E +IK+R+K ++T + E + G+ Sbjct: 305 ENN-YDLNKLSKDVKKGHLMSAFPSCNDEVYTFQERKIIKDRVKHEKTELSEKVSEQGAD 363 Query: 693 NQTSDITAQSSS 728 TA+SSS Sbjct: 364 VYDGSSTAKSSS 375 >SB_1116| Best HMM Match : THAP (HMM E-Value=0.00013) Length = 331 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +3 Query: 444 LEGTDSKPKPVLKEKSVDLVTNPERSSNNTVNYKKT---NDDDAKEKERR 584 ++ TD KP V ++KS N E + ++ KKT + +AK KE + Sbjct: 140 VKATDQKPSKVAEQKSKGQANNNEEADRSSAKEKKTTKPHQTEAKPKETK 189 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 30.3 bits (65), Expect = 1.7 Identities = 26/128 (20%), Positives = 59/128 (46%) Frame = +3 Query: 327 RKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVT 506 RK++N T ++K K + S + + ++ + ++ S+ K L+ S +++ Sbjct: 244 RKTKNHTKTPQQAKK-KRIKHTKSSSADSSDDYEVESIKVKVNFSELKKALQTFSPEILR 302 Query: 507 NPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDG 686 + KK + KEK++++ E I V+ N +KE LK+ + +K Sbjct: 303 KVKHDLEKMEREKKLGE---KEKKKKVKVLLDETISVQENALKEELKLLQQKANKVKGKI 359 Query: 687 SQNQTSDI 710 + +T+++ Sbjct: 360 HELKTTNV 367 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +3 Query: 309 NKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEK 488 NK+ R +D ++ V+S K + V+ E +K + + D+KPK + KEK Sbjct: 865 NKISSVRNGDHDRLVNVSSTDIK--DHAVEKETRRKVDSEKEVGKANHDDAKPKVIPKEK 922 >SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) Length = 521 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/119 (23%), Positives = 52/119 (43%), Gaps = 2/119 (1%) Frame = +3 Query: 318 KKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVD 497 K SRK+ T + + +K PE D + EKK ++ K + D KP+ ++K D Sbjct: 226 KTSRKTSRKTSLNRSLTTNK-PEDNADEKPEKKLDDKSEDKPEDNADEKPEDNPEDKPED 284 Query: 498 LVTN-PERSSNNTVNYK-KTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSME 668 + PE + + K K N + E +++ K + ++ R +TS++ Sbjct: 285 KTEDRPEDKPEDKLEDKPKENQQNKPEDKQQTTPKTSRKTSQKTSLNASRKTSRKTSLK 343 >SB_35298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +3 Query: 378 TPEPIVDSEQEKKREEDLWAKFLEGTDSK-PKPVLKEKSVDLVTNPERSSNNTVNYKKTN 554 +PE I + KK EE +++FL ++ PK V+ +K V PE +S +T Sbjct: 30 SPEAIPPQNEPKKPEEGRFSRFLSSMLAEPPKDVIDDKKPSDVQKPE-ASPSTQRQGNVA 88 Query: 555 DDDAKEKER 581 ++AK +++ Sbjct: 89 GNEAKVEDQ 97 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/98 (18%), Positives = 40/98 (40%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 +++ K +K R N+ + + + KT ++ ++E + + ++K + Sbjct: 1460 DQLTKTQKQRTQCNEQLDETRVKLQKTKADLIAMQKELSNNQSSLDNITKNKENKDSTLA 1519 Query: 480 KEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFE 593 KS S + YK+ ++ E ERR F+ Sbjct: 1520 DIKSKYAALEARLSEVTSELYKQQTQNELMELERREFQ 1557 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 29.9 bits (64), Expect = 2.3 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = +3 Query: 321 KSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDS---KPKPVLKEKS 491 K R + + + Q E+++ E + + QEK RE D K +EG + + +L+E+ Sbjct: 1356 KERSVETEKLKQTLQEREEQIERLKEEFQEKSRELDKMRKEVEGGGALVETLQELLRERC 1415 Query: 492 VDL-VTNPERSSNNTVNYKKTNDDDAKEKE 578 ++ V + S V K +D E+E Sbjct: 1416 EEVDVLKEKISDKRQVQDKNPASNDKAEEE 1445 >SB_12442| Best HMM Match : zf-MYND (HMM E-Value=0.0028) Length = 3809 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/91 (21%), Positives = 41/91 (45%) Frame = +3 Query: 306 INKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKE 485 + + + +++ + Q + + + EP+ + +E + EE+ + E + S+ KPV Sbjct: 1636 VTHIPEESETEIKPVKQPSEQIEPEEEPVTQTSEESEPEEEPMTQIPEESMSEAKPV--- 1692 Query: 486 KSVDLVTNPERSSNNTVNYKKTNDDDAKEKE 578 V PE S N K+T ++ E E Sbjct: 1693 -----VHIPEESEPEVKNSKQTPEESGPEVE 1718 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.9 bits (64), Expect = 2.3 Identities = 27/132 (20%), Positives = 61/132 (46%) Frame = +3 Query: 303 KINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLK 482 ++ ++ + + + +V EKD + E +++ + ++ EE D + P LK Sbjct: 2885 EVKRLLEGEREDGPSCEEVDEEKDISEEELLEEVEVQRVEEGA------SHDLEDVPALK 2938 Query: 483 EKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETS 662 E + V E + + ++ ND++ KEK+ +I + E N+I++ + E Sbjct: 2939 ESYEEEV---EVMAVGLKHEERVNDEEIKEKDEKIH-------LDEENIIQDLEETFEEE 2988 Query: 663 MEAIKSDGSQNQ 698 +E + S+N+ Sbjct: 2989 LEVSAVETSKNE 3000 >SB_1562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 738 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 450 GTDSKPKPVLKEKSVDLVTNPE-RSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENN 626 G +++ KPV K+ +L+T + R NT + KT + E + R AG ++N+ Sbjct: 641 GLNTRYKPVAASKTTELITESKTRKKQNTGS--KTRTEQIAESDTRTKPLAGSNTPIDND 698 >SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 624 NVIKERLKVDETSMEAIKSDGSQNQTSDITAQSSSS 731 N +KE K E S+ K+ GSQ+ +S ++ Q SSS Sbjct: 242 NSLKEYCKASELSINLDKTKGSQSISSSLSLQLSSS 277 >SB_29614| Best HMM Match : Flavodoxin_1 (HMM E-Value=0.22) Length = 726 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = +2 Query: 161 SGSESDEDYVPGEPE---KLSEEES-ADDETEK 247 S E+D DY+P E E K E E+ ADDE EK Sbjct: 212 SQEEADPDYIPSEDEEEAKQQENETEADDEEEK 244 >SB_17867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 149 IIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 +++ SG++ +E+ E E+ EEE ++E EK+ E E E Sbjct: 1 MVIKSGADEEEE--EEEEEEEEEEEEEEEEEEKEEEEEEE 38 >SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1455 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +3 Query: 321 KSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDL 500 +S S+N+ Q D + + EQE++ E AK ++ D PKP D+ Sbjct: 573 QSLVSKNEQCRQKVGVTDDDDDDEANLEQEEEILEQTLAKLVDEDDDTPKPYTSSGYKDI 632 Query: 501 VTNP 512 T P Sbjct: 633 PTMP 636 >SB_7993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 29.5 bits (63), Expect = 3.0 Identities = 25/123 (20%), Positives = 54/123 (43%), Gaps = 5/123 (4%) Frame = +3 Query: 354 QVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNT 533 Q T+E+ E + QE+ + + +GT K ++ ++ ++ P++S+ Sbjct: 511 QETAEEKDNSETTESNVQEEGKSMETSESAAQGTSDKDATKVESETNEVPDEPKQSAETQ 570 Query: 534 --VNYKKTN---DDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQNQ 698 V+ KK + D+ E + + GE++ + V D +EA++++G Q Sbjct: 571 EKVDSKKGSPKTDEGGVADEAKAAK--GEEMGEDQKVTAAGSSEDTAGLEAVETEGGAEQ 628 Query: 699 TSD 707 D Sbjct: 629 QGD 631 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 197 EPEKLSEEESADDETEKQYEHEVEGK 274 E EK SEEE A++ET+ + E E EG+ Sbjct: 404 EEEKGSEEEKAEEETKHEDEGEGEGE 429 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEE---SADDETEKQYEHEVEGK 274 E ED G EK +EEE S +++ E++ +HE EG+ Sbjct: 388 EQAEDEEKGSAEKTAEEEEKGSEEEKAEEETKHEDEGE 425 >SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREED 428 +K K KK +K N I EK++ E + E+E+++EE+ Sbjct: 117 KKKKKKKKKKKKINKKKINKVEEKEEGEEEEEEGEEEEEKEEE 159 >SB_31610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGK 274 E +E+ E E+ EEE ++E E++ E E EG+ Sbjct: 24 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEGE 58 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/84 (23%), Positives = 40/84 (47%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 +K + ++S S DT EK+ E + E+EK++EE + E K + Sbjct: 596 QKKEEKEESSHSDEDTSRDRNREKENDREREKEREKEKEKEERDKEREKEKEKEKEREKE 655 Query: 480 KEKSVDLVTNPERSSNNTVNYKKT 551 KE+ + + ++SS+ +K++ Sbjct: 656 KEREREKERDRDKSSHKKRRHKRS 679 >SB_59462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 29.1 bits (62), Expect = 4.0 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 6/77 (7%) Frame = +3 Query: 381 PEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTV------NY 542 P P+ +S E D EG P +KE+ LV P +N + N Sbjct: 20 PTPLCESRMVPSDENDPRYSHSEGGSPSPMESIKER---LVVPPSHDNNRDIADSTLNNR 76 Query: 543 KKTNDDDAKEKERRIFE 593 KK + E+E R+F+ Sbjct: 77 KKKRRKNPNEEESRVFQ 93 >SB_47950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 29.1 bits (62), Expect = 4.0 Identities = 33/145 (22%), Positives = 59/145 (40%) Frame = +3 Query: 303 KINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLK 482 K +K+KK K + + S+K+K S+Q +E K K K V Sbjct: 111 KKSKIKKREKEEKYGLCNHESQKEKEISICKGSDQGLVEKELFSLKKKGKKAKKAKNVKT 170 Query: 483 EKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETS 662 K VD+ + S N V K+ ++ ++ + E I + +N + K ET Sbjct: 171 VKEVDM--DDSDGSANAVKAKEQTSRTKRKGKKEKRKRKTEVIEISDNEASDTGKAKETK 228 Query: 663 MEAIKSDGSQNQTSDITAQSSSSAN 737 ++ K D + ++ + S S+ N Sbjct: 229 IKK-KKDKERVESILEISDSESAEN 252 >SB_29636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 155 MSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVEG 271 + G+E DED + G E + A DE EK E+++ G Sbjct: 133 LEGGTEGDEDALEGGTEGDDDAPEAFDEEEKPEENDMGG 171 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = +2 Query: 125 KLGNFLFVIIMSSGSESD-EDYVPGEPEKLSEEES--ADDETE 244 KLG F ++ S+G E D E+YV G P KL +E+S D+ T+ Sbjct: 1305 KLGEF---VLPSAGHEGDREEYVEGNP-KLKDEDSYTVDENTD 1343 >SB_56336| Best HMM Match : Ag332 (HMM E-Value=5.1) Length = 366 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/127 (19%), Positives = 58/127 (45%) Frame = +3 Query: 318 KKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVD 497 K+ + +T + EK++ E +V+ E +K+ + K E + +PK +E++VD Sbjct: 230 KQEGPVEEETRQEEPDEKEREQEELVEEEPKKEEPVEEETKQEEPVEEEPK---QEEAVD 286 Query: 498 LVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIK 677 P++ K+ + ++E +I E E+ V E ++ ++ + E ++ Sbjct: 287 --EEPKKEEQVDGEPKQEEQVEELKQEEQIEEPKQEEPVEEEPKQEKPVEEEPKKEEPVE 344 Query: 678 SDGSQNQ 698 + Q + Sbjct: 345 EEPKQEE 351 >SB_48649| Best HMM Match : DUF809 (HMM E-Value=1.3) Length = 222 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/50 (24%), Positives = 30/50 (60%) Frame = +3 Query: 315 VKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSK 464 V ++ + ++ + +V E + +PI +SE+E++ EE++ + + G D + Sbjct: 88 VNQTGRDESRVLFEVAREAYYSHKPIPESEEEEEAEEEVVKREVIGNDKR 137 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +2 Query: 152 IMSSGSESDEDYVPGE---PEKLSEEESADDETEKQYEHEVEGKI 277 + SS ESDE + GE P+ +E+E + ETE+Q V G I Sbjct: 259 VSSSEEESDEGDLFGEKKKPKDENEDEEENSETEEQPRKPVGGPI 303 >SB_39219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1951 Score = 28.7 bits (61), Expect = 5.3 Identities = 32/133 (24%), Positives = 56/133 (42%) Frame = +3 Query: 309 NKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEK 488 N++K + + V E + I SE K E + + EG D K Sbjct: 1774 NEMKSAGEDHEMKESDVVKESNSQDAGIKKSENVKFNESEA-DEVKEGEDVK-------- 1824 Query: 489 SVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSME 668 V+ + E + +N ++ K ND DA++K RR + E V+E++ + S + Sbjct: 1825 -VNAREDAEFNESNAIDVKGENDSDARDKPRR--DQVNEIGVIEDDKSLMKPSASMESRQ 1881 Query: 669 AIKSDGSQNQTSD 707 + S ++ TSD Sbjct: 1882 SPLSKEGEDVTSD 1894 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 5.3 Identities = 24/124 (19%), Positives = 52/124 (41%), Gaps = 2/124 (1%) Frame = +3 Query: 333 SQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNP 512 S++D + E++K + + ++ K E+ + + P EK D Sbjct: 204 SESDDDEEEEEEEEKEEKKLTQKKKGKTPEQKKTPGTKKAASKQRHPT-DEKRKDGQEKV 262 Query: 513 ERSSNNTVNYKKTNDDDAKEKER--RIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDG 686 E V +T +++ K+KE R + EK+ + +KER + ++ +A K + Sbjct: 263 EEKEKGEVEDAQTTEEEEKQKEEAERKKQEKLEKLAKKKEELKERKRQEKLEQKAKKKEK 322 Query: 687 SQNQ 698 + + Sbjct: 323 ERQE 326 >SB_21440| Best HMM Match : RNA_pol_A_bac (HMM E-Value=0.0073) Length = 287 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/79 (25%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +3 Query: 510 PERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIK-SDG 686 P + NYKK D++A++ +FE K + N K+ DE + + + G Sbjct: 200 PIHADPRLFNYKKQGDEEAQDDTTLVFELK-VKCIKNKNAPKDATDPDELYINSKEVCTG 258 Query: 687 SQNQTSDITAQSSSSANPG 743 + T SS +PG Sbjct: 259 PEMIQGPETIPKSSPTDPG 277 >SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 8/103 (7%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPE---PIVDSEQ---EKKREEDLWAKFLEGTD- 458 E + KV K K + D + +E+ K P+ P+V + EK++ E+ L Sbjct: 959 EDVKKVVKMTKEKEDWFNKKCNEQAKVPDTKDPVVLAVSILAEKQQLENTCLPILNKPKP 1018 Query: 459 -SKPKPVLKEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERR 584 KP+P KE+ + TV + DD+A +++ + Sbjct: 1019 TKKPEPPPKEEDKKTEDAGAKKDGETVENAEKMDDEAPQEQNK 1061 >SB_5458| Best HMM Match : E-MAP-115 (HMM E-Value=0.3) Length = 274 Score = 28.7 bits (61), Expect = 5.3 Identities = 29/109 (26%), Positives = 51/109 (46%) Frame = +3 Query: 369 KDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVNYKK 548 +DK IV + +EK +E L A+ D + K + K++S DL +R K+ Sbjct: 108 RDKEAYSIVRNREEKAKEAALKAREKREKD-RIKYIKKQES-DL----KRREQWQKEMKQ 161 Query: 549 TNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQN 695 D+ E+E++ + EKI+ E K +L++ + E K S + Sbjct: 162 KKDEQVDEREKQREKHRQEKIMREQMSRKIKLRIVQKRSEDDKRQESNH 210 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.7 bits (61), Expect = 5.3 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +3 Query: 360 TSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPK-PVLKEKSVDLVTNPERSSNNTV 536 T D++ EP + +EK +EE L L+ + K + +L+E++ L E T+ Sbjct: 1869 TGVDDESDEPASEEAEEKTKEEKL-KSMLDSSKLKTEAKILREETERLKAQLE----ETM 1923 Query: 537 NYKKTNDDDAKEKERRIFE 593 N K+ D E +FE Sbjct: 1924 NLKEELQDKLHTAEHELFE 1942 >SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) Length = 1089 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/114 (21%), Positives = 56/114 (49%), Gaps = 6/114 (5%) Frame = +3 Query: 354 QVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSV----DLVTNPERS 521 ++TSE D T E + SE + E+D+ + E + + E ++ D+ ++ + + Sbjct: 65 KLTSEDDITSEDDITSEDDITTEDDITS---EDDITSEDDITSEDNITSEDDITSDDDIT 121 Query: 522 SNNTVNYKK--TNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIK 677 S++ + T++DD ++ E A ++++ N + + V E+ EAI+ Sbjct: 122 SDDDITSDDDITSEDDITSEDNITTEPAIKEVIDRANELLDDDYVTESEKEAIR 175 >SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 28.7 bits (61), Expect = 5.3 Identities = 32/128 (25%), Positives = 58/128 (45%) Frame = +3 Query: 321 KSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDL 500 KS K T + ++ ++P P DS + KK+ + +DS+ +P KEKS Sbjct: 41 KSHKKSKKT--KKHRKRSRSPTP--DSGKSKKKRHH--SPSASESDSEKRPKGKEKSRKD 94 Query: 501 VTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKS 680 + ++ + + K+ D ++++RR E + ++ E KER E S +A K Sbjct: 95 ADDSDQERDRS---KRDKKDRKEKRDRRSKERSKDESKEERRRSKER----ENSPDAKKG 147 Query: 681 DGSQNQTS 704 +N S Sbjct: 148 KDKENSDS 155 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGK 274 E +E+ E E ++EEE +ETEK+ + E E + Sbjct: 67 EEEEEEEEEETEAVNEEEEKIEETEKEKDEEEENE 101 >SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) Length = 4240 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/90 (27%), Positives = 40/90 (44%) Frame = +3 Query: 312 KVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKS 491 KV K NDT+ + +K PE V EKK EE +++F+ S+P P K Sbjct: 2610 KVLPKDKPTNDTLAE---KKVSKPEDTV----EKKSEEGRFSRFISSMLSEPDPAHPGK- 2661 Query: 492 VDLVTNPERSSNNTVNYKKTNDDDAKEKER 581 D + + S + + D+ KE ++ Sbjct: 2662 -DKEQDKKDDSTQVLPARMVVQDEKKEAKK 2690 >SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +2 Query: 152 IMSSGSESDEDYVPGE---PEKLSEEESADDETEKQYEHEVEGKI 277 + SS ESDE + GE P+ +E+E + ETE+Q V G I Sbjct: 123 VSSSEEESDEGDLFGEKKKPKDENEDEEENSETEEQPRKPVGGPI 167 >SB_3121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGKI 277 ES DY+ + EK +E+ DD+ E + + E ++ Sbjct: 33 ESKHDYIQTDTEKEVDEDDDDDDLETEQDENKENEV 68 >SB_1343| Best HMM Match : IBB (HMM E-Value=2.3) Length = 556 Score = 28.7 bits (61), Expect = 5.3 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 1/92 (1%) Frame = +3 Query: 312 KVKKSRKSQNDTIIQVTSEKDKTP-EPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEK 488 K K S K Q+ + + P + + +++QE +RE++ + K PV + Sbjct: 436 KFKASTKVCGPLAEQIKQQTHELPCDAVQEAQQEARREKNEYLKSRCAEVKSSLPVNMLR 495 Query: 489 SVDLVTNPERSSNNTVNYKKTNDDDAKEKERR 584 +VDL T SS TV + D ++E R Sbjct: 496 AVDLATQKGASSWLTVLPLREMSFDLNKREFR 527 >SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 28.3 bits (60), Expect = 7.0 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 2/94 (2%) Frame = +3 Query: 366 EKDKTPEPIVDSEQEKKRE--EDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVN 539 +++ T E + + KK E ED+ AKF EG + K V K +S + + ++ + Sbjct: 160 QQETTVETGMRGDNVKKEEIAEDIIAKFSEGNQVEEK-VKKRRSFGIFKDKDKEKDK--- 215 Query: 540 YKKTNDDDAKEKERRIFEFAGEKIVVENNVIKER 641 +K + E E A ++I+VE +KE+ Sbjct: 216 -EKAGSVISLETADFEKEEAADEILVEKTEVKEK 248 >SB_39173| Best HMM Match : DUF689 (HMM E-Value=3.1) Length = 371 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 318 KKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREE 425 KKS KS+ TI+ S ++ T E + EQE E+ Sbjct: 16 KKSAKSKTPTIVDGISTEEMTKEQVELKEQELSHED 51 >SB_35042| Best HMM Match : S-antigen (HMM E-Value=3) Length = 165 Score = 28.3 bits (60), Expect = 7.0 Identities = 30/123 (24%), Positives = 51/123 (41%) Frame = +3 Query: 360 TSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVN 539 +S DK + +S QE + D AK + + P + E S + NN ++ Sbjct: 2 SSSDDKQSDSSENSNQEPTKSLD--AK--DKPNESETPSVVEASAH-GKQESSAENNDLS 56 Query: 540 YKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQNQTSDITAQ 719 ++D D K+K + E ++ + K DE+S+E+ K S+N A Sbjct: 57 KAPSSDSDVKDKLDIVISSQVENPIIAD---KNSGLSDESSLESKKPSSSENVAETFPAG 113 Query: 720 SSS 728 SS Sbjct: 114 ESS 116 >SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 28.3 bits (60), Expect = 7.0 Identities = 29/144 (20%), Positives = 56/144 (38%), Gaps = 8/144 (5%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVL 479 EK K++ + K ND I ++ + + D+E + EE + D K Sbjct: 809 EKTKKLESNLKDNNDKIKELEKKLQDVTGKLKDAESKASDEEKRALELKNKLDISNKKST 868 Query: 480 K----EKSVDLVTNPER-SSNNTVNY---KKTNDDDAKEKERRIFEFAGEKIVVENNVIK 635 K E+ + V P+R S+ + + + + N D KE ++E + + Sbjct: 869 KYEGVEEGENSVARPQRVSAGSAIRHSTPRYQNQDKTAIKEESLYETNADSYTYSEP--E 926 Query: 636 ERLKVDETSMEAIKSDGSQNQTSD 707 + V + SM+ G + +D Sbjct: 927 RKAPVSDYSMKVGPEQGYTGRRAD 950 >SB_58197| Best HMM Match : Ribosomal_L5_C (HMM E-Value=3) Length = 582 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 4/35 (11%) Frame = +2 Query: 161 SGSESDEDYVPGEPEKLSE----EESADDETEKQY 253 S E+D DY+P + E+ ++ E ADDE EK Y Sbjct: 21 SQEEADPDYIPRKDEEGAQQQENETEADDEEEKFY 55 >SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) Length = 855 Score = 28.3 bits (60), Expect = 7.0 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +3 Query: 315 VKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKRE--EDLWAKFLEGTDSKPKPVLKEK 488 VKK + N I TS+ + EPI D+ +EKK E ED + + D K V E+ Sbjct: 238 VKKYSQFINFPIFLWTSKTTEVEEPIDDAPEEKKEEAAEDKKDEEKKDEDKKDDDVEVEE 297 Query: 489 SVD 497 D Sbjct: 298 DKD 300 >SB_47763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 152 IMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGK 274 +M+ + DE+ E E+ EEE ++E EK+ E E E K Sbjct: 44 LMTDDDDDDEEEEEEEEEEEEEEEEKEEE-EKEEEEEEEEK 83 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 E +E+ V E E+ EE ++E EK+ E EVE Sbjct: 35 EEEEEEVEKEEEEEEVEEEEEEEEEKEDEIEVE 67 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/113 (16%), Positives = 53/113 (46%), Gaps = 2/113 (1%) Frame = +3 Query: 309 NKVKKSRKSQNDTIIQVTSEKDKTPEPI--VDSEQEKKREEDLWAKFLEGTDSKPKPVLK 482 NK ++ + + + Q E+++T E + E+E+ EE+ + E + K + + Sbjct: 62 NKRRRRKNNTEEEEEQTEEEEEQTEEEEEQTEEEEEQTEEEEEQTEEEEEEEEKEEGKEE 121 Query: 483 EKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKER 641 + ++VT+ S++ ++++ + ++ E G ++ V + ++ R Sbjct: 122 DGEEEVVTDERGISSSKDESNESDESNESDESNESDESNGSELAVTDMLVTTR 174 >SB_25538| Best HMM Match : Kinesin (HMM E-Value=0) Length = 711 Score = 28.3 bits (60), Expect = 7.0 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 7/89 (7%) Frame = +3 Query: 486 KSVDLVTNPERSSNNTVNYKKTNDDDAKEK-----ERRIFEFAGEKIVVENNVIKERLKV 650 +S+ + PE + N +K ++ + K + R E + +++ N +KE++ Sbjct: 308 ESIQQLGFPEAAPAAMSNAEKKKYENERSKLFLQLDERDDEIQSQSLII--NQLKEQIAE 365 Query: 651 DETSMEAIKSDGS--QNQTSDITAQSSSS 731 E S++A +SD Q Q + I A+S +S Sbjct: 366 QEESLKASRSDNERLQTQINSIQAESETS 394 >SB_24403| Best HMM Match : BRF1 (HMM E-Value=1.2) Length = 623 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +2 Query: 119 KNKLGNFLFVIIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 K KL ++I +G SDE PG PE + E+E DD + E +E Sbjct: 306 KQKLNGDAAIVI--NGVNSDESN-PGTPEVVDEDELEDDNELQAKEQLIE 352 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 417 REEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERS 521 ++E+ FL+ TD PK VLK V++V E+S Sbjct: 155 QDENSLCYFLQATDPHPKDVLKITEVNVVFAEEKS 189 >SB_58524| Best HMM Match : Ank (HMM E-Value=3.4e-16) Length = 1003 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 137 FLFVIIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGK 274 +L +I S S+ +E+ + ++ E+E + E EK+ E + EG+ Sbjct: 562 YLLLIDCSEKSKDEEEDKEKKKKEKGEKEKVEKEEEKEEEEDGEGR 607 >SB_54260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 E +E+ E E+ EEE ++E EK+ E E E Sbjct: 2 EEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEE 34 >SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) Length = 1301 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = +2 Query: 155 MSSGSESDEDYV-PGEPEKLSEEESADDETEKQ 250 +SS SES+ D++ E+ SEE++ ++ +EK+ Sbjct: 119 VSSSSESESDFITSSSSEESSEEDTEEENSEKK 151 >SB_43371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 137 FLFVIIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGK 274 +L +I S S+ +E+ + ++ E+E + E EK+ E + EG+ Sbjct: 12 YLLLIDCSEKSKDEEEDKEKKKKEKGEKEKVEKEEEKEEEEDGEGR 57 >SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHE 262 + ++D +P E ++EE+ ++E EKQ E E Sbjct: 239 DKEDDRIPTYEEIVNEEDEDENEVEKQEEFE 269 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +3 Query: 567 KEKERRIFEFAGEKIV-VENNVIKER 641 K+K RRIF +AG+K++ V N+ K R Sbjct: 258 KKKNRRIFTYAGQKMICVYTNLNKNR 283 >SB_30182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +3 Query: 507 NPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKS 680 +P+ SN TVN + NDDD + + ++ F+ + ++ L +E S+ K+ Sbjct: 71 HPKYISNITVNQWRVNDDDPNQPDYQLLAFSPTGV----ELVSAELNNEEPSVNLFKN 124 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 152 IMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 +M + +E E V EP+ EEE DD E+ E E Sbjct: 610 LMDAYTERPEKEVSKEPQTEQEEEEVDDTAEEHVPSEEE 648 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 27.9 bits (59), Expect = 9.3 Identities = 29/109 (26%), Positives = 51/109 (46%) Frame = +3 Query: 369 KDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDLVTNPERSSNNTVNYKK 548 +DK IV + +EK +E L A+ D + K + K++S DL +R K+ Sbjct: 104 RDKEAYSIVRNREEKAKEAALKAREKREKD-RIKYIKKQES-DL----KRREQWQKEMKQ 157 Query: 549 TNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQN 695 D+ E+E++ + EKI+ E K +L++ + E K S + Sbjct: 158 KKDEQVDEREKQREKQRQEKIMREQMSRKIKLRIVQKRSEDDKRQESNH 206 >SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) Length = 1178 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 119 KNKLGNFLFVIIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 K+K N L ++ SG + DY +K++E E E +KQ+ + ++ Sbjct: 239 KDKQINELKSLVEQSGENAQHDYEKKLNDKIAEFEQEKFEMQKQHTNNIQ 288 >SB_12456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 E +E+ E E+ EEE ++E EK+ E E E Sbjct: 104 EEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEE 136 >SB_56330| Best HMM Match : PP1_inhibitor (HMM E-Value=8.4) Length = 160 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 4/88 (4%) Frame = +3 Query: 486 KSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENN---VIKERLKVDE 656 KSV+ P S + + T +D KE++ +I E G+ V N V+ E ++D Sbjct: 19 KSVEEDEEPLISLTDLIKRLTTLEDSLKERDGKILELEGQLDVAFNKIKVVVGELQRIDN 78 Query: 657 TSMEAIK-SDGSQNQTSDITAQSSSSAN 737 ++ + SD + +T + + +++ + Sbjct: 79 DLIQNVNDSDELRERTEECERRQANNTD 106 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 480 KEKSVDLVTNPERSSNNTVNYKKTNDDDAKE 572 K S + T P NNT+ ++TN+D AK+ Sbjct: 207 KTPSHTITTVPPSQQNNTILQEQTNEDHAKQ 237 >SB_52889| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) Length = 623 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +3 Query: 507 NPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKS 680 +P+ SN TVN + NDDD + + ++ F+ + ++ L +E S+ K+ Sbjct: 404 HPKYISNITVNQWRVNDDDPNQPDYQLLAFSPTGV----ELVSAELNNEEPSVNLFKN 457 >SB_43079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 369 KDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKEKSVDL 500 +D+T +S +EK+ E D W K + K +KE +V L Sbjct: 449 EDQTNTKGDESSEEKESERDSWVKVTDEDVENAKSEMKEDTVKL 492 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 176 DEDYVPGEPE-KLSEEESADDETEKQYEHEVE 268 +E+ GE E + EEE ++E EK+ E+EVE Sbjct: 94 EEEKEGGEEENEEEEEEETEEEEEKEEEYEVE 125 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 137 FLFVIIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 +LF + S E +E+ E+ EEE ++E E++ E E E Sbjct: 185 YLFAVPASVVEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEE 228 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 170 ESDEDYVPGEPEKLSEEESADDETEKQYEHEVE 268 E +E+ E E+ EEE ++E EK+ E E E Sbjct: 212 EEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEE 244 >SB_35886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 27.9 bits (59), Expect = 9.3 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 1/114 (0%) Frame = +3 Query: 309 NKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEGTDSKPKPVLKE- 485 N+ + + +++ T+I+ T +PE IVD QEK+ TDS + K Sbjct: 230 NEKELTDDTESRTMIRETVWNQCSPEVIVDKGQEKRN--------ASSTDSPAMEIYKRT 281 Query: 486 KSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLK 647 + D V + S N + K T+ A +K+ + + + +E + ERLK Sbjct: 282 TAADYVV--QTSEPNVTSTKLTDHGLASDKKSNLIDGGNRRPSME--LTNERLK 331 >SB_30526| Best HMM Match : LRR_1 (HMM E-Value=8e-08) Length = 219 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 134 NFLFVIIMSSGSESDEDYVPGEPEKLSEEESADDETEKQYEHE 262 N L + S E ED+ PGE E E+E DDE ++ E + Sbjct: 165 NCLVFMYDSQEEEEGEDFNPGEDE---EDEDFDDEDDELNEEQ 204 >SB_26014| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) Length = 578 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +3 Query: 507 NPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKS 680 +P+ SN TVN + NDDD + + ++ F+ + ++ L +E S+ K+ Sbjct: 461 HPKYISNITVNQWRVNDDDPNQPDYQLLAFSPTGV----ELVSAELNNEEPSVNLFKN 514 >SB_24802| Best HMM Match : Phage_fiber_C (HMM E-Value=1.1) Length = 1072 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 552 NDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQN 695 +DD E +FE + N+ + RL ET E+++ SQ+ Sbjct: 347 SDDSGSRHEDDVFESVPSMLSKAKNLFQRRLNAGETGAESVRLARSQS 394 >SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) Length = 323 Score = 27.9 bits (59), Expect = 9.3 Identities = 27/148 (18%), Positives = 62/148 (41%), Gaps = 2/148 (1%) Frame = +3 Query: 300 EKINKVKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAKFLEG--TDSKPKP 473 + + ++ +K + T Q+T E++ E + E+E+ EE+ + EG D + + Sbjct: 16 QHLKDLEFKKKKRQSTSRQITEEEE---EEQTEEEEEQTEEEEEEEEKEEGKEEDGEEEV 72 Query: 474 VLKEKSVDLVTNPERSSNNTVNYKKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVD 653 V E+ + + S+ + ++N+ D K E + E + + ++ Sbjct: 73 VTDERGISSSKDESDESDESNESDESNESD-KSNESDESNESDESNESDESNESDKSNES 131 Query: 654 ETSMEAIKSDGSQNQTSDITAQSSSSAN 737 + S E+ KS+ S + + +N Sbjct: 132 DKSNESDKSNESDKRNESDESDEDDESN 159 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 167 SESDEDYVPGEPEKLSEEESADDETEKQYEHEVEGK 274 SES+ + E E EEES + ++E+ E E E K Sbjct: 698 SESESESEESEEESEEEEESEESDSEESEEEEEEIK 733 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.9 bits (59), Expect = 9.3 Identities = 26/125 (20%), Positives = 50/125 (40%), Gaps = 1/125 (0%) Frame = +3 Query: 366 EKDKTPEPIVDSEQEKKREEDLWAKFLE-GTDSKPKPVLKEKSVDLVTNPERSSNNTVNY 542 ++DK D + + +ED +F T+ K + K++ L E Sbjct: 870 DRDKEVSLAKDKSRNETSKEDDTDEFQRIMTEIKMRAEKKDEERHLREEEEERQRKEAAK 929 Query: 543 KKTNDDDAKEKERRIFEFAGEKIVVENNVIKERLKVDETSMEAIKSDGSQNQTSDITAQS 722 K +++ KEKE A ++ ++ K+R K + D + S+ + S Sbjct: 930 GKKEEEEKKEKEAEERRRAEDEERIKKQAEKDRKKAIKKRKRRSWKDSMASLESESSTTS 989 Query: 723 SSSAN 737 SSS++ Sbjct: 990 SSSSS 994 >SB_5528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 9.3 Identities = 9/42 (21%), Positives = 24/42 (57%) Frame = +3 Query: 315 VKKSRKSQNDTIIQVTSEKDKTPEPIVDSEQEKKREEDLWAK 440 +++S Q Q+ E+++ + +D+E+++K ++ W K Sbjct: 33 IERSIAGQKRKAAQIAEEQEEVEKTEIDAEEDEKEDDRYWYK 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,715,894 Number of Sequences: 59808 Number of extensions: 295871 Number of successful extensions: 1892 Number of sequences better than 10.0: 94 Number of HSP's better than 10.0 without gapping: 1570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1850 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -