BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0845 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 5.3 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 22 7.1 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.3 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.3 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 600 GEKIVVENNVIKERLKVDETSMEAIK-SDGSQNQTSD 707 GEKIVV N ++++ +E E K D TSD Sbjct: 1533 GEKIVVSRNKAYQKVEENEIIFEIYKMGDRFIGLTSD 1569 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 636 ERLKVDETSMEAIKSDGSQNQTSDITAQSSSSANP 740 +R K +E ++ I DGS +Q+ SSA P Sbjct: 610 KRGKYEEPTVGEISQDGSSPHFHQSPSQNHSSAVP 644 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 434 GEVS*RNRFKA*TSS*RKKC 493 GE+S + F+ TS RKKC Sbjct: 24 GEISDIDEFREMTSKYRKKC 43 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 428 IFFSFFLLFRVNYWF 384 +F FFL V YWF Sbjct: 430 VFPLFFLAINVFYWF 444 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 609 IVVENNVIKERLKVDETSMEAIKSD 683 I +E+NV R+K++ T +I +D Sbjct: 619 IRIEDNVATLRMKLNPTKAASINAD 643 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,799 Number of Sequences: 438 Number of extensions: 3209 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -