BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0844 (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_27756| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_8305| Best HMM Match : Plasmodium_HRP (HMM E-Value=8.8) 30 1.7 SB_48395| Best HMM Match : MAM (HMM E-Value=0) 30 1.7 SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) 30 2.2 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_46326| Best HMM Match : Scramblase (HMM E-Value=0) 29 2.9 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_28586| Best HMM Match : DNA_primase_lrg (HMM E-Value=3.7e-05) 29 5.1 SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_55550| Best HMM Match : PLAC8 (HMM E-Value=0.00022) 28 6.7 SB_53703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_31091| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) 28 8.9 SB_14537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 28 8.9 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 28 8.9 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +2 Query: 140 PIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQN 277 P P + PP P P YP PP N+ YP Y PP N Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 176 PPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQN 277 PP P P P Y PP N YP Y PP N Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 137 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY---PQNTYAPPQN 277 PP P + PP P P YP Y PP N Y P Y PP N Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +2 Query: 137 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQN---TYAPPQN 277 PP + P PP P P P Y PP N+ YP + Y PP N Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +2 Query: 137 PPIQWKPQNTWNAPP-KPIQPINTYP---QNNYAPPQNSYY---PQNTYAPPQN 277 PP + P + PP P P YP Y PP N+ Y P Y PP N Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPN 137 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 176 PPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQN 277 PP P P P Y PP N+ P Y PP N Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNA--PNPPYPPPPN 227 >SB_27756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 155 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPPQNTYR 286 P ++ P K QP P +Y PP SY P +Y PP +Y+ Sbjct: 429 PHKSYQPPHKSYQP----PHKSYQPPHKSYQPPHKSYQPPHKSYQ 469 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 155 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPPQNTYR 286 P ++ P K QP P +Y PP SY P +Y PP +Y+ Sbjct: 436 PHKSYQPPHKSYQP----PHKSYQPPHKSYQPPHKSYQPPHKSYQ 476 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +2 Query: 149 WKPQNTWNAPPKPIQP-INTY--PQNNYAPPQNSYY-PQNTYAPPQNTYR 286 + P++ + P K QP +Y P +Y PP SY P +Y PP +Y+ Sbjct: 406 YDPESQFRPPFKSYQPPYKSYQPPHKSYQPPHKSYQPPHKSYQPPHKSYQ 455 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 155 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPPQNTYR 286 P ++ P K QP P +Y PP SY P +Y PP +Y+ Sbjct: 422 PYKSYQPPHKSYQP----PHKSYQPPHKSYQPPHKSYQPPHKSYQ 462 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 155 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPPQNTYR 286 P ++ P K QP P +Y PP SY P +Y PP +Y+ Sbjct: 443 PHKSYQPPHKSYQP----PHKSYQPPHKSYQPPHKSYQPPYKSYQ 483 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 155 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPPQNTYR 286 P ++ P K QP P +Y PP SY P +Y PP +Y+ Sbjct: 457 PHKSYQPPHKSYQP----PHKSYQPPYKSYQPPYKSYQPPYKSYQ 497 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 31.1 bits (67), Expect = 0.96 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 173 APPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNT 280 +PP P P ++ APP+ S P + APPQ T Sbjct: 738 SPPSSKHPPTVSPSSSSAPPRPSTPPSVSSAPPQTT 773 >SB_8305| Best HMM Match : Plasmodium_HRP (HMM E-Value=8.8) Length = 366 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +2 Query: 152 KPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNT 280 +P N N P IQP +TY Q + QN P +TY P +T Sbjct: 17 QPNNPCN-PTTYIQPKDTYNQTTHTTQQNK-QPNDTYNPTTHT 57 >SB_48395| Best HMM Match : MAM (HMM E-Value=0) Length = 901 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -2 Query: 633 LPLWHFDQG-LPE*QQVRXEEWVNGPRKHGSQSCRPSSGRCKLSHQLQCKSTSPFSPGL 460 L LW D+ P V W + GS + P SGR + + +++SPF PG+ Sbjct: 310 LCLWRNDKNNTPTNDGVYNFNWFSHNGPTGSANTGPPSGRGGSGYYIYLETSSPFQPGM 368 >SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) Length = 1536 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 155 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTYR 286 P + +NA +P+Q + P PQ APP N+Y+ Sbjct: 645 PGSQYNASSEPVQMFDYLPPGQSGRSMRPSMPQYPQAPPYNSYQ 688 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 158 QNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTYR 286 +NT PP P Q T N +PPQ N PP NT R Sbjct: 475 ENTRRNPPPPSQDPTT---GNPSPPQEQPTTGNPTPPPNNTLR 514 >SB_46326| Best HMM Match : Scramblase (HMM E-Value=0) Length = 554 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +2 Query: 155 PQNTWNAPPKPIQP--INTYPQNNYAPPQNSYYP--QNTYAPPQNTY 283 PQ + PP +Q PQ Y PPQ Y P Q Y P Q Y Sbjct: 237 PQGYGHPPPVDVQSGYAGQPPQQGYPPPQGGYPPPQQPGYNPQQPGY 283 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 137 PPIQWKPQNTWNAPP--KPIQPINTYPQNNYAPPQNSYYPQNT 259 PP Q P APP +P+QP + Y PPQ YP ++ Sbjct: 451 PPSQSTPSQ--QAPPTKQPMQPQHQYQARPGGPPQQRQYPPSS 491 >SB_3702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 29.1 bits (62), Expect = 3.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 167 WNAPPKPIQPINTYPQNNYAPP 232 ++ PP+ + TYP NNY PP Sbjct: 14 YSQPPQGYPGVQTYPINNYPPP 35 >SB_28586| Best HMM Match : DNA_primase_lrg (HMM E-Value=3.7e-05) Length = 322 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 247 SSEYLCTSSKHLSSHLEHAFISDFDYNNSRPSDQ 348 S EY SKHLS L H +IS+ + S +D+ Sbjct: 71 SKEYKEKMSKHLSDFLPHLYISNMYSSKSTANDE 104 >SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 149 WKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYP---QNTYAP-PQNTY 283 + P + + PP P Q Q +Y P YP Q +Y P PQ +Y Sbjct: 302 YPPTSQQSYPPTPQQSYPLTSQQSYLPTSQQSYPPTSQQSYPPSPQQSY 350 >SB_55550| Best HMM Match : PLAC8 (HMM E-Value=0.00022) Length = 236 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +2 Query: 161 NTWNAPPKPIQPINT---YPQNNYAPPQNSYYPQNTYAPPQNTY 283 N P+ QP+ YP PPQ Y PQ Y Q T+ Sbjct: 11 NRMQEGPEMAQPVTGQPGYPPQQGYPPQQGYPPQQGYPHAQTTH 54 >SB_53703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 378 SYKYEYQIADGTHVGEEGYFTNPNTE 455 S ++E +I DG G++G F + NTE Sbjct: 43 STQWEVKIQDGARTGQKGIFRDDNTE 68 >SB_31091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 173 APPKPIQPINTYPQNNYAPPQNSYY 247 APP P PI T PP N YY Sbjct: 41 APPMPTVPIQTPSAPYQPPPSNDYY 65 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +2 Query: 143 IQWKPQNTWNAPPKPIQPINTYPQ---NNYA--PPQNSYYPQNTYAPP 271 +Q +P PP P N YP NYA PP Y PQ APP Sbjct: 356 LQGQPPPGTYYPPPPQGNYNQYPVPGGQNYAGAPPPPYYPPQEYQAPP 403 >SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 130 PEPAYPVETSKYVERSTQADPADKH--LSPKQLRPPSK 237 P+P P+ SK R T+ A KH LS + R P K Sbjct: 307 PQPTKPLPASKEASRKTKKSAASKHRILSVRLHRKPKK 344 >SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 564 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +2 Query: 137 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNT 280 P + P AP P Q + TYP+ + + P P T PP T Sbjct: 19 PAVPNSPPGGNGAPVLPHQEVATYPEASNSCPSIHVLPDVTARPPSCT 66 >SB_14537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +2 Query: 137 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAP 268 P +++P NT P QP Y N P Y+P Y P Sbjct: 31 PSTRYQP-NTRYQPNTRYQPNTQYQPNTRYQPNTRYHPNTRYQP 73 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 387 YEYQIADGTHVGEEGYFTNPNTEEASLVKKGWYSYTGA 500 Y + +A G+ +G T P+T+ + GWY+YT A Sbjct: 3913 YAWVVAQGS-TSTQG--TGPSTDHTTGTANGWYAYTDA 3947 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +2 Query: 137 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQ 274 PP Q P P P + AP Q Y+PQ PPQ Sbjct: 798 PPTQGGPPQAQPPPHAPPGQAHYQQLGAAAPNQGGYHPQQPPPPPQ 843 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,368,915 Number of Sequences: 59808 Number of extensions: 503974 Number of successful extensions: 1744 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1719 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -