BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0840 (590 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 0.97 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 5.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.0 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 9.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.0 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.2 bits (50), Expect = 0.97 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +3 Query: 267 KDPCXGLYRYQNRVLCNSIDLPIHNPTWFSINGRSKNFNALLRRHRLYSY 416 +DP Y++ N S N TW +N K+ N ++ YS+ Sbjct: 419 RDPERTPYQWDNST---SAGFSQTNKTWLPVNENYKSLNLAAQKREYYSH 465 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -3 Query: 507 LVVHGRVQSVNEFQIFRTVRSSICSHYEENSSY 409 + +HG VQS +++ + V ++ ++E Y Sbjct: 107 VTMHGTVQSYDKYDLLENVNNAARINWEYLDKY 139 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +1 Query: 178 CMFSPRLYKIYF 213 C++SP++Y I F Sbjct: 754 CLYSPKIYIILF 765 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 451 YSPKYLKFIDTLDS 492 Y PKY+K +D +S Sbjct: 234 YDPKYIKMMDAGES 247 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 178 CMFSPRLYKI 207 C+FSP+LY I Sbjct: 896 CLFSPKLYII 905 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +1 Query: 178 CMFSPRLYKIYF 213 C++SP++Y I F Sbjct: 844 CLYSPKIYIILF 855 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,226 Number of Sequences: 438 Number of extensions: 3640 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -