BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0838 (610 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.38 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 3.5 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 3.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.4 bits (53), Expect = 0.38 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 23 TLLTWRTSAQSSTSPDAGSLPTTTRSPTREGYLSPLVAVLFE 148 T T RT+ T+ + PTTT PT+ + P V+ E Sbjct: 1054 TTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPE 1095 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 3.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 105 VGERVVVGREPASGDVLDWADV 40 +GE + VG P + WAD+ Sbjct: 485 IGENITVGVNPEPERMKFWADI 506 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.2 bits (45), Expect = 3.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 105 VGERVVVGREPASGDVLDWADV 40 +GE + VG P + WAD+ Sbjct: 487 IGENITVGVNPEPERMKFWADI 508 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/43 (23%), Positives = 18/43 (41%) Frame = -3 Query: 551 TYVMKHTSIHFSRTTGLICSNSKPLHSQFNIITYNDHDNNLQE 423 T + K H + +C N + ++ TYN+ N L + Sbjct: 318 TNLEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLAD 360 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/43 (23%), Positives = 18/43 (41%) Frame = -3 Query: 551 TYVMKHTSIHFSRTTGLICSNSKPLHSQFNIITYNDHDNNLQE 423 T + K H + +C N + ++ TYN+ N L + Sbjct: 210 TNLEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLAD 252 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,073 Number of Sequences: 336 Number of extensions: 2981 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -