BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0837 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53344-5|AAA96226.2| 442|Caenorhabditis elegans More of ms prot... 30 1.4 AF013489-1|AAC47728.1| 442|Caenorhabditis elegans MOM-1 protein. 30 1.4 AF106582-1|AAC78217.3| 1424|Caenorhabditis elegans Hypothetical ... 29 2.4 Z48809-9|CAA88749.1| 1270|Caenorhabditis elegans Hypothetical pr... 27 9.8 Z48583-5|CAA88473.1| 1270|Caenorhabditis elegans Hypothetical pr... 27 9.8 >U53344-5|AAA96226.2| 442|Caenorhabditis elegans More of ms protein 1 protein. Length = 442 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 526 SRYRSCRLLGTCPSVTSSRSCYHWHSRKQAR 434 +RY C CP ++S SC H HS K R Sbjct: 350 ARYSMCVAAKACPVRSNSLSCKHRHSNKTGR 380 >AF013489-1|AAC47728.1| 442|Caenorhabditis elegans MOM-1 protein. Length = 442 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 526 SRYRSCRLLGTCPSVTSSRSCYHWHSRKQAR 434 +RY C CP ++S SC H HS K R Sbjct: 350 ARYSMCVAAKACPVRSNSLSCKHRHSNKTGR 380 >AF106582-1|AAC78217.3| 1424|Caenorhabditis elegans Hypothetical protein W05F2.7 protein. Length = 1424 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 265 SNGD-INSAGDILTQNQQ----KGWWTIGLINSRYRYLTAETFGFKINANGTS 408 S GD +++A + LT N G W G +NS R+LT T+ N NGT+ Sbjct: 982 STGDFLSNAWNSLTSNNSTGGGNGTWISGALNSTGRFLT-NTWNLLGNCNGTA 1033 >Z48809-9|CAA88749.1| 1270|Caenorhabditis elegans Hypothetical protein T01E8.5 protein. Length = 1270 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -1 Query: 664 RCRSVCPSWSPGNSHARRYAAPSGR 590 R RS S SP SH+RRY +GR Sbjct: 139 RKRSASNSRSPSRSHSRRYDRDNGR 163 >Z48583-5|CAA88473.1| 1270|Caenorhabditis elegans Hypothetical protein T01E8.5 protein. Length = 1270 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -1 Query: 664 RCRSVCPSWSPGNSHARRYAAPSGR 590 R RS S SP SH+RRY +GR Sbjct: 139 RKRSASNSRSPSRSHSRRYDRDNGR 163 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,482,197 Number of Sequences: 27780 Number of extensions: 280282 Number of successful extensions: 749 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -