BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0836 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.52 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 1.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.9 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 8.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.4 bits (53), Expect = 0.52 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 536 FESSTSSLMCGLTRCIRSLSGLLQGTEPFGST*TRVPSMVELLDNSDES 390 ++ T + G TR + + G L TEP GS + PSM + S ES Sbjct: 179 YQCRTKHRLTGETR-LSATKGRLVITEPVGSVRPKFPSMDNINGLSTES 226 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 560 NEIHILSKFESSTSSLMCGLTR 495 N +HILSK++ TS+ + L R Sbjct: 24 NSVHILSKYQLITSTTLNWLPR 45 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 364 EPNAKRQRLDSSELSSNSTIEGTRVYVLPNGSVPCN 471 EP+A R R E+ S I GT+ +V +PC+ Sbjct: 518 EPSACRPR---HEIRSTDVIPGTQEHVCGVKGIPCS 550 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 343 PPATSNNEPNAKRQRLDSSEL 405 PP T E N K+ LDS ++ Sbjct: 317 PPETEEEEENDKKLDLDSIDM 337 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 241 PEKIVKLNELLETSNFQNRNLSDVHQDLNIPIPTPPATS 357 P+ ++L + L Q + +SD + TPPA+S Sbjct: 333 PKYRLELQKRLPWLELQEKPISDSTSTTTETVNTPPASS 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,732 Number of Sequences: 438 Number of extensions: 4299 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -