BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0831 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 26 5.4 SPAC23G3.12c |||serine protease |Schizosaccharomyces pombe|chr 1... 25 9.5 SPBC26H8.02c |sec9||SNAP-25 homologue, t-SNARE component Sec9|Sc... 25 9.5 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.8 bits (54), Expect = 5.4 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 Query: 550 HDRFPPQYNSKRPHXTHAARANDDPATPHDLHFLLTESLLKLND 419 HDRF P Y + + A R D DL + LL L+D Sbjct: 461 HDRFSPPYMAGEQYAREARRLALDNFDRPDLSLVAALLLLSLHD 504 >SPAC23G3.12c |||serine protease |Schizosaccharomyces pombe|chr 1|||Manual Length = 996 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +3 Query: 3 SFAESTTGIGNATH*EDSARNSVGCVYRVNLIAEPFVASDGFDENDELE 149 +F +G G A+ A+N R + A PFV FD ++E+E Sbjct: 73 AFDTDESGTGEASAFVVDAKNGYMLTNRHVVCAGPFVGHAVFDNHEEVE 121 >SPBC26H8.02c |sec9||SNAP-25 homologue, t-SNARE component Sec9|Schizosaccharomyces pombe|chr 2|||Manual Length = 419 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 156 SVRASEHETEPRTAPLTDISGYKLQEKFTGGRI 254 S +E + R+AP D K QE F G RI Sbjct: 126 SAAVTERPSMHRSAPSQDTLDLKKQELFAGARI 158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,327,325 Number of Sequences: 5004 Number of extensions: 40382 Number of successful extensions: 83 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -