BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0831 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59120.1 68416.m06591 DC1 domain-containing protein contains ... 29 2.0 At2g26640.1 68415.m03196 beta-ketoacyl-CoA synthase, putative si... 28 6.2 >At3g59120.1 68416.m06591 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 602 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 157 VCEHLNTRLSHALHH*PTLVD 219 VC +L +L HALHH P +D Sbjct: 357 VCANLPRKLEHALHHHPLFID 377 >At2g26640.1 68415.m03196 beta-ketoacyl-CoA synthase, putative similar to beta-ketoacyl-CoA synthase [Simmondsia chinensis][GI:1045614] Length = 509 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -1 Query: 443 RKLIKIK*LSFNYTPIVTRGCYCTYSGIVIGMSRELSTKS 324 +K +K+K + Y ++T G Y S +V+ ++ ++ST S Sbjct: 21 KKSVKLKYVKLGYHYLITHGMYLFLSPLVLVIAAQISTFS 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,395,437 Number of Sequences: 28952 Number of extensions: 216232 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -