BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0827 (619 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4XJT6 Cluster: Putative uncharacterized protein; n=1; ... 29 0.11 UniRef50_Q170V7 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_UPI0000DBF0DB Cluster: UPI0000DBF0DB related cluster; n... 29 0.45 UniRef50_Q4TA27 Cluster: Chromosome undetermined SCAF7470, whole... 27 1.3 UniRef50_Q8C7P2 Cluster: 12 days embryo spinal cord cDNA, RIKEN ... 27 1.5 UniRef50_Q9D443 Cluster: Adult male testis cDNA, RIKEN full-leng... 27 2.0 UniRef50_Q4TBG6 Cluster: Chromosome undetermined SCAF7129, whole... 27 2.6 UniRef50_Q3MJF2 Cluster: Il17rd protein; n=3; Mus musculus|Rep: ... 29 3.1 UniRef50_UPI0000DB7C9F Cluster: PREDICTED: similar to ubiquitin ... 34 3.1 UniRef50_Q54R08 Cluster: Putative uncharacterized protein; n=1; ... 29 3.5 UniRef50_A6NLV9 Cluster: Uncharacterized protein VAPB; n=1; Homo... 27 5.3 UniRef50_Q4T7P0 Cluster: Chromosome undetermined SCAF8068, whole... 33 5.5 UniRef50_A7CQD0 Cluster: 1,4-alpha-glucan branching enzyme; n=1;... 33 5.5 UniRef50_UPI00015A451D Cluster: UPI00015A451D related cluster; n... 26 5.7 UniRef50_Q4Q158 Cluster: Putative uncharacterized protein; n=2; ... 33 7.2 UniRef50_UPI00015A7172 Cluster: otopetrin 1; n=1; Danio rerio|Re... 27 7.9 UniRef50_Q08C51 Cluster: Zgc:153610; n=12; Euteleostomi|Rep: Zgc... 26 8.4 >UniRef50_Q4XJT6 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 44 Score = 29.5 bits (63), Expect(2) = 0.11 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 508 TNVVKYVFLIFDCVCVCVCL 449 T+V +++L+ CVCVCVC+ Sbjct: 4 TDVHHHIWLVCVCVCVCVCV 23 Score = 28.7 bits (61), Expect(2) = 0.11 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -1 Query: 472 CVCVCVCLFH 443 CVCVCVC++H Sbjct: 22 CVCVCVCMYH 31 >UniRef50_Q170V7 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 355 Score = 37.5 bits (83), Expect = 0.25 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +2 Query: 14 PKPTSPARGAPCRSTNEALAETWSQKNQKLSPQVRSTAT 130 P+PT PA +P R TN A + + N K SP R+T T Sbjct: 200 PQPTKPAEKSPSRKTNSASKKKPKKSNSKSSPAKRTTTT 238 >UniRef50_UPI0000DBF0DB Cluster: UPI0000DBF0DB related cluster; n=2; Rattus norvegicus|Rep: UPI0000DBF0DB UniRef100 entry - Rattus norvegicus Length = 278 Score = 29.1 bits (62), Expect(2) = 0.45 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -1 Query: 472 CVCVCVCLFH-NYSNSHIFD--YIKKHSYDIERLNIH 371 CVCVCVC+F Y+ ++I ++K+H+ ++ +IH Sbjct: 222 CVCVCVCMFRCTYTITYIKHCCHLKQHTQKYQK-SIH 257 Score = 26.6 bits (56), Expect(2) = 0.45 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 481 IFDCVCVCVCL 449 IF CVCVCVC+ Sbjct: 213 IFVCVCVCVCV 223 >UniRef50_Q4TA27 Cluster: Chromosome undetermined SCAF7470, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF7470, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 381 Score = 27.5 bits (58), Expect(2) = 1.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 472 CVCVCVCLFHNYS 434 CVCVCVC+ YS Sbjct: 276 CVCVCVCVSQGYS 288 Score = 26.6 bits (56), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -1 Query: 478 FDCVCVCVCL 449 F+CVCVCVC+ Sbjct: 270 FNCVCVCVCV 279 >UniRef50_Q8C7P2 Cluster: 12 days embryo spinal cord cDNA, RIKEN full-length enriched library, clone:C530050K14 product:hypothetical protein, full insert sequence (0 day neonate thymus cDNA, RIKEN full-length enriched library, clone:A430098G12 product:phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), full insert sequence); n=1; Mus musculus|Rep: 12 days embryo spinal cord cDNA, RIKEN full-length enriched library, clone:C530050K14 product:hypothetical protein, full insert sequence (0 day neonate thymus cDNA, RIKEN full-length enriched library, clone:A430098G12 product:phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), full insert sequence) - Mus musculus (Mouse) Length = 109 Score = 27.5 bits (58), Expect(2) = 1.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 472 CVCVCVCLFHNYSNSHIFDYIK 407 CVCVCVC+F + +F IK Sbjct: 39 CVCVCVCVFLYFFAIALFCLIK 60 Score = 26.6 bits (56), Expect(2) = 1.5 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -1 Query: 484 LIFDCVCVCVCL 449 L++ CVCVCVC+ Sbjct: 33 LVYVCVCVCVCV 44 >UniRef50_Q9D443 Cluster: Adult male testis cDNA, RIKEN full-length enriched library, clone:4933415A04 product:hypothetical protein, full insert sequence; n=1; Mus musculus|Rep: Adult male testis cDNA, RIKEN full-length enriched library, clone:4933415A04 product:hypothetical protein, full insert sequence - Mus musculus (Mouse) Length = 101 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 508 TNVVKYVFLIFDCVCVCVCL 449 T++ F+ + CVCVCVC+ Sbjct: 23 TSIGTCTFVCYLCVCVCVCV 42 Score = 26.6 bits (56), Expect(2) = 2.0 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 472 CVCVCVCLF 446 CVCVCVC+F Sbjct: 51 CVCVCVCMF 59 >UniRef50_Q4TBG6 Cluster: Chromosome undetermined SCAF7129, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF7129, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1063 Score = 26.6 bits (56), Expect(2) = 2.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 472 CVCVCVCLFHNYSNSHIFDYIKK 404 CVCVCVC+ H+F + + Sbjct: 563 CVCVCVCVCGGGGRLHMFRQVPR 585 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 475 DCVCVCVCL 449 DCVCVCVC+ Sbjct: 560 DCVCVCVCV 568 >UniRef50_Q3MJF2 Cluster: Il17rd protein; n=3; Mus musculus|Rep: Il17rd protein - Mus musculus (Mouse) Length = 140 Score = 28.7 bits (61), Expect(2) = 3.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 490 VFLIFDCVCVCVCL 449 +F +F CVCVCVC+ Sbjct: 43 IFNVFICVCVCVCV 56 Score = 24.2 bits (50), Expect(2) = 3.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 472 CVCVCVCLFH 443 CVCVCVC+ + Sbjct: 51 CVCVCVCVLN 60 >UniRef50_UPI0000DB7C9F Cluster: PREDICTED: similar to ubiquitin protein ligase E3A isoform 3; n=1; Apis mellifera|Rep: PREDICTED: similar to ubiquitin protein ligase E3A isoform 3 - Apis mellifera Length = 898 Score = 33.9 bits (74), Expect = 3.1 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 11 EPKPTSPARGAPCRSTNEALAETW--SQKNQKLSPQVRSTATLPVRDDVSL 157 EP P S A+ P +S N ++ S N KL P TLPV+ D+S+ Sbjct: 99 EPGPASLAKSLPVKSVNPTCSDEGIASNFNIKLVPSTTDILTLPVKMDISV 149 >UniRef50_Q54R08 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 46 Score = 28.7 bits (61), Expect(2) = 3.5 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 472 CVCVCVCLFHN 440 CVCVCVC+F N Sbjct: 20 CVCVCVCVFEN 30 Score = 24.2 bits (50), Expect(2) = 3.5 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -1 Query: 493 YVF-LIFDCVCVCVCL 449 YV+ + CVCVCVC+ Sbjct: 10 YVYKCAYMCVCVCVCV 25 >UniRef50_A6NLV9 Cluster: Uncharacterized protein VAPB; n=1; Homo sapiens|Rep: Uncharacterized protein VAPB - Homo sapiens (Human) Length = 132 Score = 26.6 bits (56), Expect(2) = 5.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 472 CVCVCVCLFHNYSNS 428 CVCVCVC+F + +S Sbjct: 40 CVCVCVCVFFFWLSS 54 Score = 25.4 bits (53), Expect(2) = 5.3 Identities = 11/17 (64%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 496 KYVFLIFD-CVCVCVCL 449 KYVF CVCVCVC+ Sbjct: 27 KYVFHDLTLCVCVCVCV 43 >UniRef50_Q4T7P0 Cluster: Chromosome undetermined SCAF8068, whole genome shotgun sequence; n=7; Deuterostomia|Rep: Chromosome undetermined SCAF8068, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1001 Score = 33.1 bits (72), Expect = 5.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 499 VKYVFLIFDCVCVCVCLFHNYSNSHIFDYIKKHSYDI 389 ++Y L+F C C+C F + S H+ +++K H DI Sbjct: 959 MEYCVLLF---CCCICGFESTSKEHLMEHMKDHEGDI 992 >UniRef50_A7CQD0 Cluster: 1,4-alpha-glucan branching enzyme; n=1; Opitutaceae bacterium TAV2|Rep: 1,4-alpha-glucan branching enzyme - Opitutaceae bacterium TAV2 Length = 780 Score = 33.1 bits (72), Expect = 5.5 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 5 PSEPKPTSPARGAPCRSTNEALAET-WSQKNQKLSPQVRSTATLPVRDDV 151 PS P P PA G P R+ + A +T S +SP + T+ PV D+ Sbjct: 57 PSPPPPPPPAAGKPARAKSAAKGKTAKSAVAAPISPAIAPTSAQPVAHDM 106 >UniRef50_UPI00015A451D Cluster: UPI00015A451D related cluster; n=1; Danio rerio|Rep: UPI00015A451D UniRef100 entry - Danio rerio Length = 1281 Score = 26.2 bits (55), Expect(2) = 5.7 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 472 CVCVCVCLF 446 CVCVCVC+F Sbjct: 1012 CVCVCVCVF 1020 Score = 26.2 bits (55), Expect(2) = 9.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 481 IFDCVCVCVCL 449 +F CVCVCVC+ Sbjct: 1019 VFVCVCVCVCV 1029 Score = 25.4 bits (53), Expect(2) = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 490 VFLIFDCVCVCVCL 449 + +I CVCVCVC+ Sbjct: 1004 IIIICVCVCVCVCV 1017 Score = 24.6 bits (51), Expect(2) = 9.7 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 1/12 (8%) Frame = -1 Query: 472 CVCVCVCL-FHN 440 CVCVCVC+ HN Sbjct: 1032 CVCVCVCVCVHN 1043 >UniRef50_Q4Q158 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 580 Score = 32.7 bits (71), Expect = 7.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 472 CVCVCVCLFHNYSNSHIFDYIKKH 401 CVCVC C++ YS H K+H Sbjct: 7 CVCVCACMYGPYSEDHYAGPAKRH 30 >UniRef50_UPI00015A7172 Cluster: otopetrin 1; n=1; Danio rerio|Rep: otopetrin 1 - Danio rerio Length = 502 Score = 26.6 bits (56), Expect(2) = 7.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 472 CVCVCVCLFHNYSNSH 425 CVCVCV + H N H Sbjct: 249 CVCVCVSIVHFCKNDH 264 Score = 24.6 bits (51), Expect(2) = 7.9 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -1 Query: 475 DCVCVCVCL 449 +CVCVCVC+ Sbjct: 242 ECVCVCVCV 250 >UniRef50_Q08C51 Cluster: Zgc:153610; n=12; Euteleostomi|Rep: Zgc:153610 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 252 Score = 26.2 bits (55), Expect(2) = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 481 IFDCVCVCVCL 449 +F CVCVCVC+ Sbjct: 216 VFVCVCVCVCV 226 Score = 25.0 bits (52), Expect(2) = 8.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 472 CVCVCVCLF 446 CVCVCVC F Sbjct: 243 CVCVCVCWF 251 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,670,215 Number of Sequences: 1657284 Number of extensions: 8058798 Number of successful extensions: 27767 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 23712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27199 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44807090004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -