BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0827 (619 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) 31 0.99 SB_36628| Best HMM Match : Bac_Ubq_Cox (HMM E-Value=1.1) 30 1.7 SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_47874| Best HMM Match : Keratin_B2 (HMM E-Value=4.9) 28 7.0 SB_45644| Best HMM Match : zf-HYPF (HMM E-Value=3.7) 27 9.2 SB_17096| Best HMM Match : Novirhabdo_Nv (HMM E-Value=2.4) 27 9.2 SB_8517| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_2957| Best HMM Match : zf-HYPF (HMM E-Value=3.1) 27 9.2 >SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) Length = 463 Score = 30.7 bits (66), Expect = 0.99 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 394 HSCAF*-CNRIYGY*NNYETDTRTHTHNR 477 H+C + CN+IYG ++ + TRTHT R Sbjct: 364 HACTYAGCNKIYGKSSHLKAHTRTHTGER 392 >SB_36628| Best HMM Match : Bac_Ubq_Cox (HMM E-Value=1.1) Length = 461 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 505 NVVKYVFLIFDCVCVCVCLFHNYSNSHIFDYIK-KHSYDIER 383 N+V +FL+F + + + S+ HIF ++K K YDI R Sbjct: 213 NIVLVLFLMFALTALIKTILNVESDEHIFKFVKAKLGYDIGR 254 >SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1668 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 284 NKFSKSWLHSKNHQKQADTL 225 NK K+W+H ++QK DT+ Sbjct: 1171 NKEHKAWMHKSDYQKNTDTV 1190 >SB_47874| Best HMM Match : Keratin_B2 (HMM E-Value=4.9) Length = 253 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 256 LCNHDLLNLFSHVITIGLWLSYCSSTTCNSMLDCRF*VYEYLTSQC-HSCAF*CN 417 +CNH L +++H +T ++ +T CN L LT+ C H+ CN Sbjct: 9 MCNHTLATMYNHTLT--TMCNHTLTTMCNHTLTAM--CNHTLTTMCNHTLTTMCN 59 >SB_45644| Best HMM Match : zf-HYPF (HMM E-Value=3.7) Length = 172 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 55 NERGSGGDVVAKEPKTQPSGSIDRNLT 135 N+ G DV EPK QP +++RN T Sbjct: 61 NDEYKGPDVFDLEPKLQPFSNMERNST 87 >SB_17096| Best HMM Match : Novirhabdo_Nv (HMM E-Value=2.4) Length = 211 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = -3 Query: 425 YIRLH*KAQL*H*EVKYSYT*NLQSNIELHVVELQ*LNHRPIVITCENK 279 ++ LH +Q H ++ LQSNI HV + + LN+ + IT E + Sbjct: 65 FLELHIPSQTKHNSIELERV--LQSNIVYHVYDFKPLNYLMLTITKERR 111 >SB_8517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 8 SEPKPTSPARGAPCRSTNEALAETWSQKNQKLSPQVRST 124 + PKPT+ RG P + N+ A + Q+L +R T Sbjct: 64 TSPKPTTSKRGTPDTTANQITAMFVKIRKQELIIHIRMT 102 >SB_2957| Best HMM Match : zf-HYPF (HMM E-Value=3.1) Length = 150 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 55 NERGSGGDVVAKEPKTQPSGSIDRNLT 135 N+ G DV EPK QP +++RN T Sbjct: 83 NDEYKGPDVFDLEPKLQPFSNMERNST 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,969,982 Number of Sequences: 59808 Number of extensions: 257671 Number of successful extensions: 669 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -