BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0825 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 21 9.0 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.4 bits (48), Expect = 1.7 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = +2 Query: 71 HTLIPEDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIF 250 H +P+ + C L GF+++ KIV +S + GH + L+G IF Sbjct: 92 HIQLPKHVDQYLLEQLVCEQL--GGFLLILTPNGKIVFVSHTVEHLLGHLQTDLMGQSIF 149 Query: 251 N 253 N Sbjct: 150 N 150 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +3 Query: 87 KTPGPQPPSPCNVRPCVKMVSLC*RVVH 170 K GPQP S C+ C R +H Sbjct: 1269 KMGGPQPYSACSENAFAAYPGDCTRYLH 1296 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 58 TSKNTHFDTGRLRGLSHLPHAMFG 129 TS N H+ + + RGL H +M G Sbjct: 200 TSANFHYLSPQSRGLFHRGWSMSG 223 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,438 Number of Sequences: 336 Number of extensions: 3869 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -