BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0825 (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 24 4.9 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.9 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.9 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.9 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 24 4.9 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.9 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 6.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.5 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 8.5 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.8 bits (49), Expect = 4.9 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +2 Query: 263 YEDICPSTHNMDVPHVKREDYQLTDISDNGYLTLMADNGDLREDLKIPDGD 415 Y+D+ + ++V ++R DY + + L + ++ E+ PDGD Sbjct: 65 YKDVLEQNYAVEVRDIERNDYNFDEPKTS--LDPVVVEEEIIEESNGPDGD 113 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 371 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 463 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 371 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 463 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 371 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 463 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.8 bits (49), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 371 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 463 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 371 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 463 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 110 FPMQCSALRKNGFVMLKG 163 +P++ SA RK G +ML G Sbjct: 181 YPLRVSAARKRGKIMLGG 198 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 8.5 Identities = 14/68 (20%), Positives = 26/68 (38%) Frame = +2 Query: 281 STHNMDVPHVKREDYQLTDISDNGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 460 ST+N +P++ LTD + D DL + + + + + D L Sbjct: 166 STNNSVLPYITESPTDLTDAPTTSNMAASGDETDLDAITTLAESGIPSSNTSGDDRVDHL 225 Query: 461 LCTVLKSC 484 L + + C Sbjct: 226 LPSPAEQC 233 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 8.5 Identities = 14/68 (20%), Positives = 26/68 (38%) Frame = +2 Query: 281 STHNMDVPHVKREDYQLTDISDNGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 460 ST+N +P++ LTD + D DL + + + + + D L Sbjct: 167 STNNSVLPYITESPTDLTDAPTTSNMAASGDETDLDAITTLAESGIPSSNTSGDDRVDHL 226 Query: 461 LCTVLKSC 484 L + + C Sbjct: 227 LPSPAEQC 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,583 Number of Sequences: 2352 Number of extensions: 16581 Number of successful extensions: 46 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -