BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0821 (574 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5HDU3 Cluster: Drug transporter, putative; n=17; Staph... 34 2.7 UniRef50_A3CLY9 Cluster: Putative uncharacterized protein; n=1; ... 32 8.3 >UniRef50_Q5HDU3 Cluster: Drug transporter, putative; n=17; Staphylococcus|Rep: Drug transporter, putative - Staphylococcus aureus (strain COL) Length = 403 Score = 33.9 bits (74), Expect = 2.7 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 444 NRSSIIFQSIKLIHLINFIQYLCVYLIL 527 N+S I +S + L+NFI YLC+YL+L Sbjct: 8 NKSPIFTKSFTINFLVNFIVYLCMYLLL 35 >UniRef50_A3CLY9 Cluster: Putative uncharacterized protein; n=1; Streptococcus sanguinis SK36|Rep: Putative uncharacterized protein - Streptococcus sanguinis (strain SK36) Length = 254 Score = 32.3 bits (70), Expect = 8.3 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 147 HVSSLLVIFYVLVRSVQVMRTTNNTSMILISFKSSNILFNYIILE 281 ++SS +V+F +LV V + TN+ S + SF I F YIIL+ Sbjct: 110 NISSAIVLFTILVGVVFIGNITNHKSPLQWSFIDYAIAFLYIILQ 154 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,664,949 Number of Sequences: 1657284 Number of extensions: 7400001 Number of successful extensions: 16308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16293 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 39154548218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -