BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0820 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 62 4e-10 SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) 57 1e-08 SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) 56 2e-08 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 56 4e-08 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 54 9e-08 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 54 2e-07 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 53 3e-07 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 52 5e-07 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 52 7e-07 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 51 1e-06 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 51 1e-06 SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) 50 3e-06 SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) 50 3e-06 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 50 3e-06 SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 8e-06 SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 1e-05 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 47 1e-05 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) 46 2e-05 SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) 46 3e-05 SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) 46 3e-05 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 46 4e-05 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 43 3e-04 SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) 42 5e-04 SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) 42 5e-04 SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) 40 0.002 SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) 40 0.003 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 39 0.004 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) 39 0.005 SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) 39 0.005 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) 38 0.011 SB_30894| Best HMM Match : BTB (HMM E-Value=3.1e-14) 38 0.011 SB_27263| Best HMM Match : Kelch_1 (HMM E-Value=2.10055e-42) 38 0.011 SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52003| Best HMM Match : BTB (HMM E-Value=1e-16) 36 0.035 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.056 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 35 0.061 SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) 35 0.061 SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) 31 1.00 SB_47975| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_37935| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07) 30 1.7 SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) 30 2.3 SB_56853| Best HMM Match : BTB (HMM E-Value=1.1e-16) 30 2.3 SB_58368| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) 29 4.0 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_9607| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 28 7.0 SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_35972| Best HMM Match : DUF1379 (HMM E-Value=5.5) 28 7.0 SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) 28 7.0 SB_12746| Best HMM Match : DUF1379 (HMM E-Value=5.5) 28 7.0 SB_10735| Best HMM Match : rve (HMM E-Value=2.2e-17) 28 7.0 SB_54171| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_48899| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 28 7.0 SB_36000| Best HMM Match : DUF1379 (HMM E-Value=4.8) 28 7.0 SB_32624| Best HMM Match : rve (HMM E-Value=0.00042) 28 7.0 SB_23421| Best HMM Match : rve (HMM E-Value=1.8e-18) 28 7.0 SB_21695| Best HMM Match : RVT_1 (HMM E-Value=0.00068) 28 7.0 SB_39167| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_17029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35867| Best HMM Match : Fibrinogen_C (HMM E-Value=6.5e-13) 28 9.3 SB_27713| Best HMM Match : CKS (HMM E-Value=2.4) 28 9.3 SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) 28 9.3 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%) Frame = +2 Query: 113 GFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSH 286 G + L R +L DV L + AH++VLS CS YF MF N ++ ++++K + Sbjct: 21 GLNQLRQRKELCDVELCVGNVQISAHRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDE 80 Query: 287 SALRDLLQFMYQGEVNVKQEELASFISTAEQLQV 388 +AL+ L+ F Y G+ + QE + + A LQ+ Sbjct: 81 TALQLLVDFAYTGKAEITQENVQLLLPAANMLQL 114 >SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 651 Score = 57.2 bits (132), Expect = 1e-08 Identities = 34/117 (29%), Positives = 58/117 (49%), Gaps = 2/117 (1%) Frame = +2 Query: 53 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 232 MAS++ C +F + + + L S L DVTL + R L +H++VL+ SPYF M Sbjct: 1 MASEDGLLFCVPDFPTKVFSSLNELRSEEKLCDVTLVVKDRSLVSHRVVLAGWSPYFHAM 60 Query: 233 F--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 M ++ V + + +AL +L+ F Y G + E + S + + LQ+ + Sbjct: 61 LTGDMLESRLEKVTIHGIECAALEELINFCYTGRTEIHVENVQSLMCASSLLQLSNV 117 >SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/104 (31%), Positives = 57/104 (54%), Gaps = 3/104 (2%) Frame = +2 Query: 86 NNFHANMSAG-FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQH 256 NN H N + + L + L DV L A + AH++VL+ SPYF MF +++ ++ Sbjct: 20 NNEHCNKAFQVMNSLRQQNMLCDVVLKAGSIEIPAHRVVLASSSPYFFAMFTGELSESRQ 79 Query: 257 PIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQV 388 +V LK++ AL L++F+Y E+ V ++ + + A LQ+ Sbjct: 80 TVVTLKEIDSLALELLIEFVYIAEIEVTEDNVQVLLPAANLLQL 123 >SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) Length = 635 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 316 L DV L EG AH+LVL+ SP+F +F +M Q + LK V S + ++L+++ Sbjct: 33 LCDVDLMVEGLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIVLKQVKASVMENVLEYL 92 Query: 317 YQGEVNVKQEELASFISTAEQLQVKGL 397 Y G+ ++ E + +A ++GL Sbjct: 93 YTGKTSLNPENAEDLVVSASYFLIEGL 119 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 55.6 bits (128), Expect = 4e-08 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 2/89 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 316 L DVTL EG+ AH++VL+ S YF +F +M P V L+++ S + +L ++ Sbjct: 29 LCDVTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYL 88 Query: 317 YQGEVNVKQEELASFISTAEQLQVKGLTG 403 Y GE+ V + I++A L + L G Sbjct: 89 YTGEITVTELNAEDLIASANYLLIPRLKG 117 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 54.4 bits (125), Expect = 9e-08 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 2/85 (2%) Frame = +2 Query: 140 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 313 +L DV + + AH++VL+ CSPYF+ MF +M ++ + ++DV SA+ L+ F Sbjct: 57 ELCDVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITF 116 Query: 314 MYQGEVNVKQEELASFISTAEQLQV 388 Y + +++ + + + A LQ+ Sbjct: 117 AYTASITIEETNVQTLLPAACLLQL 141 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/96 (26%), Positives = 50/96 (52%), Gaps = 2/96 (2%) Frame = +2 Query: 116 FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSHS 289 F L G+L+DVTL +G ++AH++VL+ CSPYF+ M T + L + Sbjct: 29 FKELRDDGELLDVTLHVQGEEIKAHRVVLAACSPYFRAMLTTGFAETFMSTIPLHECDPV 88 Query: 290 ALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 ++ ++++ Y + + +E + +S A ++ + Sbjct: 89 GVQSIVEYFYSKRLTITKENIEGLLSAASLFEIPSI 124 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 53.2 bits (122), Expect = 2e-07 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 3/94 (3%) Frame = +2 Query: 116 FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSH 286 F+ + +L DV L + + +HKLVL+ SPYF+ MF N TQ I L D+ Sbjct: 23 FNDFRNSKELCDVLLCVDDEEIPSHKLVLAASSPYFRAMFTSNLLECTQRTIT-LYDIDV 81 Query: 287 SALRDLLQFMYQGEVNVKQEELASFISTAEQLQV 388 AL+ ++++ Y G++ + ++ + + + LQV Sbjct: 82 GALQQIVEYFYTGKITIDEDNVQFLLHASCLLQV 115 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 52.8 bits (121), Expect = 3e-07 Identities = 25/90 (27%), Positives = 50/90 (55%), Gaps = 2/90 (2%) Frame = +2 Query: 125 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALR 298 LL + L DVT+ A R ++ H++VL+ CS YF MF M + ++ ++ +S ++ Sbjct: 27 LLEQEKLCDVTIKAGERKIRCHRVVLASCSAYFHSMFTNSMLESSQEVITIQGLSEKSVI 86 Query: 299 DLLQFMYQGEVNVKQEELASFISTAEQLQV 388 L+ FMY ++ + + + S ++ + Q+ Sbjct: 87 QLINFMYTRKITITIDNIESLLTASAVFQL 116 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 52.0 bits (119), Expect = 5e-07 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 3/86 (3%) Frame = +2 Query: 137 GDLVDVTLAAE-GRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLL 307 G DV L E G+ + AHKLVLS S YF+ MF M +Q + ++ + ++ L+ Sbjct: 23 GIFCDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLV 82 Query: 308 QFMYQGEVNVKQEELASFISTAEQLQ 385 +F Y V + E + + + A LQ Sbjct: 83 EFAYTSNVRINSENVETLLYAASMLQ 108 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 51.6 bits (118), Expect = 7e-07 Identities = 31/93 (33%), Positives = 48/93 (51%), Gaps = 2/93 (2%) Frame = +2 Query: 125 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALR 298 L R L DVTL R + AH+LVL+ S YFQ MF + + V L+DV A+ Sbjct: 40 LRGRKQLCDVTLCVGERQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVTLRDVDSGAVE 99 Query: 299 DLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 L+ F Y G++++ E + S + + Q+ + Sbjct: 100 LLVDFAYTGKLDITTENVQSIMYASSLFQLNAI 132 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 51.6 bits (118), Expect = 7e-07 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 2/86 (2%) Frame = +2 Query: 149 DVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQ 322 DV L EGR H+ VL+ SP+F MF M + + L+ + A+ +L+F Y Sbjct: 57 DVILQVEGRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQSIKAKAMESILEFFYT 116 Query: 323 GEVNVKQEELASFISTAEQLQVKGLT 400 E+ ++++EL + A L + LT Sbjct: 117 QEIVLEEDELLDLLDAASFLLLPALT 142 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 51.6 bits (118), Expect = 7e-07 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 2/83 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 316 L DV L + + H+ VL+ CS YF MF ++ ++ I+ +KD+ ++ L++F Sbjct: 11 LCDVVLRIDEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFA 70 Query: 317 YQGEVNVKQEELASFISTAEQLQ 385 Y G V + E + + ++TA LQ Sbjct: 71 YTGRVEITVENVQNLLATASLLQ 93 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 2/93 (2%) Frame = +2 Query: 116 FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHS 289 F L D+ + + ++AHKLVL+ S YF MF M T V L D+ + Sbjct: 24 FEDFRKNSQLCDIKIVIGDKRIRAHKLVLASFSDYFSAMFTGDMAETSQNTVHLTDMDPA 83 Query: 290 ALRDLLQFMYQGEVNVKQEELASFISTAEQLQV 388 A++ L+ + Y E+ ++ + + + +S A LQ+ Sbjct: 84 AVQALISYSYTSEIEIRVDNVENLLSVACILQI 116 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = +2 Query: 140 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 313 +L DV L R + AH+LVL+ CS YF MF ++ ++ + L+ + A+ L++F Sbjct: 40 ELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEF 99 Query: 314 MYQGEVNVKQEELASFISTAEQLQVKGL 397 Y + V ++ + + + A LQ++ + Sbjct: 100 AYTARIQVSEDNVQALLPAASLLQLESV 127 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = +2 Query: 140 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 313 +L DV L R + AH+LVL+ CS YF MF ++ ++ + L+ + A+ L++F Sbjct: 40 ELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEF 99 Query: 314 MYQGEVNVKQEELASFISTAEQLQVKGL 397 Y + V ++ + + + A LQ++ + Sbjct: 100 AYTARIQVSEDNVQALLPAASLLQLESV 127 >SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 548 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 3/88 (3%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQF 313 L +VT+ G+ AH+ VL+ SPYF+ MF + + V L++++ + +LL F Sbjct: 49 LCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVILENITADVMEELLNF 108 Query: 314 MYQGEVNVKQEELASFISTAEQLQVKGL 397 +Y G + + + +S + L + L Sbjct: 109 IYAGTIKITPFNVKDLVSASNYLLMNSL 136 >SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 570 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 3/88 (3%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQF 313 L +VT+ G+ AH+ VL+ SPYF+ MF + + V L++++ + +LL F Sbjct: 49 LCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVILENITADVMEELLNF 108 Query: 314 MYQGEVNVKQEELASFISTAEQLQVKGL 397 +Y G + + + +S + L + L Sbjct: 109 IYAGTIKITPFNVKDLVSASNYLLMNSL 136 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 2/84 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFM 316 + D L E + HK+V+S SPYF+ +F + + V ++ + LL F+ Sbjct: 33 MCDAVLKVEEKQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFSALLDFI 92 Query: 317 YQGEVNVKQEELASFISTAEQLQV 388 Y G +NV +E + + A+ LQ+ Sbjct: 93 YTGVINVNEENVQQLLPAAKMLQL 116 >SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 48.4 bits (110), Expect = 6e-06 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 3/103 (2%) Frame = +2 Query: 86 NNFHA-NMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQH 256 ++FHA N+ L + DVT+ + +H+L+L+ S YF MF M+ T Sbjct: 15 DSFHACNVLETLRTLFQGRKMCDVTVVVGKMEIPSHRLILAANSSYFYSMFTSGMSETAQ 74 Query: 257 PIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQ 385 + LK+V + +R L+++ Y + + + + + +S LQ Sbjct: 75 NRINLKEVDATVVRQLIEYCYTSTIEINENNVQNLLSIGNLLQ 117 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 48.0 bits (109), Expect = 8e-06 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 2/114 (1%) Frame = +2 Query: 62 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF-- 235 D+ F+ + + + + L G + DV + AE AH+ +LS S YF MF Sbjct: 6 DDSFTFYDDKYSKAILHRINQLRHHGAMCDVVIKAEDTEFLAHRNILSASSDYFFAMFNG 65 Query: 236 KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 M + +V + V+ ++R +L F+Y GE+ + + + + A + V+ + Sbjct: 66 NMKESSQDVVTITGVTPDSMRSILNFIYTGEIVLDWDNVELILQGANLMLVQSV 119 >SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 595 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMY 319 L DV L +G AHK +L+ S YF MF + T V +++++ +A+ LL F+Y Sbjct: 33 LTDVVLIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRTVVVQEITSTAMEVLLAFIY 92 Query: 320 QGEVNVKQEEL 352 QG++ + +E + Sbjct: 93 QGKLLITEENV 103 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 2/88 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 316 L DV L E AHK +L+ S YF MF M + V LK + S ++++L F+ Sbjct: 40 LCDVVLLVENEEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEILDFL 99 Query: 317 YQGEVNVKQEELASFISTAEQLQVKGLT 400 Y G + + + + + + L + +T Sbjct: 100 YTGRIEIDNKNVRDLLEASSFLIISSVT 127 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 1/76 (1%) Frame = +2 Query: 173 RLLQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 349 R + AHK VLS+ S F MF TQ V L DV SA LL+F+Y EV + E Sbjct: 1622 RRIPAHKFVLSIGSAVFDAMFNGGIATQSDEVELPDVEPSAFMALLRFLYTDEVQIGPET 1681 Query: 350 LASFISTAEQLQVKGL 397 + + + TA++ + L Sbjct: 1682 VMTTLYTAKKYAIPTL 1697 >SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 316 L DVTL L AH+ +L+ SPYF+ +F +M Q + L +V + D+L ++ Sbjct: 25 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 84 Query: 317 YQGEVNVKQEELASFISTAEQL 382 Y G V V++ + A+ + Sbjct: 85 YSGSVVVEESKAIPLTVAADYM 106 >SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) Length = 398 Score = 46.0 bits (104), Expect = 3e-05 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 2/100 (2%) Frame = +2 Query: 104 MSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKD 277 +S+ LL D L A GR +AHK +L+ SP F MF +M ++ V + D Sbjct: 209 LSSHMGNLLDNATFSDTVLIAGGREFKAHKAILAARSPVFSAMFEHEMEESRKGRVEILD 268 Query: 278 VSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 + +++L+F+Y G Q ++ A++ ++ L Sbjct: 269 IDPDVFQEMLKFVYTGNTPQIQGMADDLLAAADKYDLERL 308 >SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) Length = 603 Score = 46.0 bits (104), Expect = 3e-05 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +2 Query: 149 DVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQ 322 DV L EG++ AH+ VL+ S +F MF M + + L ++ AL +L F Y Sbjct: 53 DVNLEVEGQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSILDFFYT 112 Query: 323 GEVNVKQEELASFISTAEQL 382 E+N+ ++ + + A L Sbjct: 113 REINISRDNVVDILEAASFL 132 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 45.6 bits (103), Expect = 4e-05 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 316 L DVTL L AH+ +L+ SPYF+ +F +M Q + L +V + D+L ++ Sbjct: 1394 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 1453 Query: 317 YQGEVNVKQ 343 Y G V V++ Sbjct: 1454 YSGSVVVEE 1462 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +2 Query: 137 GDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQ 310 G L DV L E + AH++VL+ CS YF MF M +Q ++ L+ ++ + LL Sbjct: 35 GKLCDVVLQVEKKEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQGLASDTMEVLLD 94 Query: 311 FMYQGEVNV 337 F+Y V + Sbjct: 95 FVYTETVKL 103 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Frame = +2 Query: 149 DVTLAAEGRLLQAHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMY 319 D+TL A +L AH++VL+ SPYF+E+ + V + A+ +L+F Y Sbjct: 42 DITLKAGNLVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVMPDSLKPGAVVAMLEFFY 101 Query: 320 QGEVNVKQEELASFISTAEQLQ 385 G + + + + ++ A ++ Sbjct: 102 SGTLQINLKSIEDLLAAASTMK 123 >SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFM 316 L DV L AHK VL S +F +F M Q V LK + + DLL ++ Sbjct: 20 LCDVELIVGNNRFAAHKNVLCASSIFFNGLFSSSMRERQENTVNLKQFPVNIMEDLLTYL 79 Query: 317 YQGEVNVKQEELASFISTAEQL 382 Y G++ V + F++ A+ L Sbjct: 80 YTGKLEVTEATAQDFLAAADFL 101 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 41.9 bits (94), Expect = 5e-04 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%) Frame = +2 Query: 53 MASDEQF---SLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYF 223 M+ DE+ S+ +F ++ + L L D + G+ HK VL SP+F Sbjct: 1 MSMDEEIHFKSVIDTDFKLSILDRLNSLRKENVLCDAVIQIGGKTHPVHKNVLCAASPFF 60 Query: 224 QEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 + +F M + L+ +S +++ FMY G + V++E + + L + L Sbjct: 61 RGLFTNDMQEKNQEHIELQVISGDVGEEVISFMYTGAIKVEKENAQDIVMAGDFLLIPSL 120 >SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) Length = 417 Score = 41.9 bits (94), Expect = 5e-04 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 1/92 (1%) Frame = +2 Query: 125 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRD 301 +LS + V T A E + AH+ VLSV SP F+ MF + + L D AL + Sbjct: 25 VLSDVEFVVCTSAGEKISIPAHRYVLSVSSPVFEAMFHGAMAESSREISLPDCYAEALSE 84 Query: 302 LLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 +L++ Y EV + + + AE+ GL Sbjct: 85 MLRYAYYDEVKLTGSNAMAVMYLAEKYNFPGL 116 >SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) Length = 259 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/86 (26%), Positives = 41/86 (47%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQ 322 L D L E + HK LS+ SP F++MF+ Q + L ++++L +Y Sbjct: 16 LSDAVLVVEEKHFNVHKSTLSMWSPVFEKMFRERNDQE--ICLPGKKSKEIKEMLLVIYP 73 Query: 323 GEVNVKQEELASFISTAEQLQVKGLT 400 V +E ++ A++ Q++ LT Sbjct: 74 TSKKVTEENCYYLLTLAQEYQMEQLT 99 >SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 5/101 (4%) Frame = +2 Query: 41 VVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPY 220 ++A S Q S+C +++ F LL DV L G A+K +LS Y Sbjct: 78 LIAQKDSITQSSICRQPV-SSLKKDFQELLENAYCSDVVLLYSGSRFHANKAILSARCSY 136 Query: 221 FQEMFKMNPTQHPIVF-----LKDVSHSALRDLLQFMYQGE 328 F++MF + + P+ + ++++S LLQ++Y G+ Sbjct: 137 FKDMFS-DESNQPLTYSVDIPVEEISTGMFASLLQYLYTGD 176 >SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) Length = 176 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = +2 Query: 137 GDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK---MNPTQHPIVFLKDVSHSALRDLL 307 G+ DVTL + HKLVL+ S YF+ MF + +++ +V L D+ + ++ Sbjct: 30 GEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVV-LHDLDPKGVNAVI 88 Query: 308 QFMYQGEVNVKQEELASFISTAEQLQVK 391 + Y ++ + + + + A VK Sbjct: 89 SYFYNSKIEINADNFGAVFAVANMWDVK 116 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 1/92 (1%) Frame = +2 Query: 125 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRD 301 +LS + + T A + AH+ VL+V SP F+ MF + V L D + AL + Sbjct: 443 VLSDVEFLVCTSAGVKISIPAHRYVLAVSSPVFEAMFHGAMAESSRKVSLPDCTAEALSE 502 Query: 302 LLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 +L++ Y EV + + S + AE+ + GL Sbjct: 503 MLRYAYFDEVELTGSNVMSVMYLAEKYILPGL 534 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 2/87 (2%) Frame = +2 Query: 143 LVDVTLAAEGR-LLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLK-DVSHSALRDLLQFM 316 + D+TL + AHK+VL+ S YF+ +F + + D+S L+ +L+++ Sbjct: 28 MCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLDISTRTLKAILKYV 87 Query: 317 YQGEVNVKQEELASFISTAEQLQVKGL 397 Y G+V++ S A+ L + L Sbjct: 88 YCGDVSLNVSNARSVFVAADYLMMDHL 114 >SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) Length = 467 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +2 Query: 185 AHKLVLSVCSPYFQEMFKMNPTQH-PIVFLKDVSHSALRDLLQFMYQGEV 331 AHK VLSV SP F+ MF N + P V L D + ++LL+++Y +V Sbjct: 45 AHKFVLSVSSPVFEAMFFGNLAESGPTVRLPDCTVDGFQELLRYLYCDQV 94 >SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) Length = 619 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 4/89 (4%) Frame = +2 Query: 137 GDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDL 304 G+ DVTL + HKLVL+ S YF+ MF + + V L D+ + + Sbjct: 72 GEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGLREGFVESSKNDVVLHDLDPKGVNAV 131 Query: 305 LQFMYQGEVNVKQEELASFISTAEQLQVK 391 + + Y ++ + + + + A VK Sbjct: 132 ISYFYNSKIEINADNFEAVFAVANMWDVK 160 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = +2 Query: 41 VVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPY 220 V A+ Q S NF A + ++ ++ DVT EG HK++L+ SP Sbjct: 458 VFAVFEDAVQHSKSSKNFGIYTGADY---VNNQEMSDVTFVVEGEPFYGHKIILATASPR 514 Query: 221 FQEMFKMNPTQH 256 F++M + P+++ Sbjct: 515 FKQMLTIKPSEN 526 >SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) Length = 239 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Frame = +2 Query: 140 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMY 319 D DV L E + HK +L + SP F+ MF+ PI L + + DL+ +Y Sbjct: 16 DESDVILVVEEQEFHVHKFILKMASPVFKAMFEHVKDSKPIQ-LPGKKFNQVLDLMNHIY 74 Query: 320 QGEVN--VKQEELASFISTAEQLQVKGLTGN 406 N + + + + A + Q+K +T + Sbjct: 75 PTSNNSSITMDNVEHLSALAAEYQIKAVTNS 105 >SB_30894| Best HMM Match : BTB (HMM E-Value=3.1e-14) Length = 159 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/87 (21%), Positives = 45/87 (51%), Gaps = 2/87 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQE-MFKMNPTQHPIVFLK-DVSHSALRDLLQFM 316 L DV + + +AH +++S+ S YF++ + + ++ + LK ++ L ++L F+ Sbjct: 43 LCDVEVIVSDGVSKAHGVIISIGSEYFRDRLTAIACRENKRIELKYKITKGTLENVLDFL 102 Query: 317 YQGEVNVKQEELASFISTAEQLQVKGL 397 Y G + + + + + A L++ L Sbjct: 103 YSGNIKITESNACALLEAAVYLRISSL 129 >SB_27263| Best HMM Match : Kelch_1 (HMM E-Value=2.10055e-42) Length = 559 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/87 (21%), Positives = 45/87 (51%), Gaps = 2/87 (2%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQE-MFKMNPTQHPIVFLK-DVSHSALRDLLQFM 316 L DV + + +AH +++S+ S YF++ + + ++ + LK ++ L ++L F+ Sbjct: 55 LCDVEVIVSDGVSKAHGVIISIGSEYFRDRLTAIACRENKRIELKYKITKGTLENVLDFL 114 Query: 317 YQGEVNVKQEELASFISTAEQLQVKGL 397 Y G + + + + + A L++ L Sbjct: 115 YSGNIKITESNACALLEAAVYLRISSL 141 >SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 36.3 bits (80), Expect = 0.027 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Frame = +2 Query: 143 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSH---SALRDLLQF 313 L DVTL R + HK+VL+ SPYF+ +F + + + ++ S+ A+ +++ + Sbjct: 47 LCDVTLRHNERRIPCHKVVLAARSPYFRHLFINSESGQYVKNVELPSYFSILAVDEVINY 106 Query: 314 MYQGEVNVKQEELASFISTAEQLQVKGL 397 +Y G+++ A +++ L Sbjct: 107 LYSGKLHFTPTNTVDIFKCALHIELDAL 134 >SB_52003| Best HMM Match : BTB (HMM E-Value=1e-16) Length = 501 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/102 (21%), Positives = 48/102 (47%), Gaps = 9/102 (8%) Frame = +2 Query: 128 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQ---------EMFKMNPTQHPIVFLKDV 280 LS + V + + ++ AH+ L+V SP F+ E K+ + ++ + + Sbjct: 84 LSDVEFVCTSAGVQEVIIPAHRYALAVGSPVFKTNFEDRWSAEKLKLTDSSKLLIPIANY 143 Query: 281 SHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGLTGN 406 + ++L+++Y GEV + + + + +EQ + GL N Sbjct: 144 TAEGFSEMLRYVYYGEVELSESNVMEIMYLSEQYDLPGLQVN 185 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 31.1 bits (67), Expect(2) = 0.056 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = +2 Query: 125 LLSRGDLVDV--TLAAEGRLLQAHKLVLSVCSPYFQEMF----KMN--PTQHPIVFLKDV 280 +L D DV T + L AH+ +LS SP F+E+F K+N P ++ +F D+ Sbjct: 243 VLGNDDSADVKFTFSGNAPTLHAHQTILSAASPIFRELFLGSKKVNAVPRKYQAIF-SDI 301 Query: 281 SHS 289 S S Sbjct: 302 SWS 304 Score = 23.0 bits (47), Expect(2) = 0.056 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +2 Query: 275 DVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVK 391 D+S + +LQF+Y G + E + F+ ++ K Sbjct: 329 DISCESFEKILQFLYTGLPGFSEIEDSDFVLDVKKTAAK 367 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = +2 Query: 179 LQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELA 355 + HKL+L++ SP F MF + Q + + D + +LL++ Y E + +E + Sbjct: 2776 IPGHKLILAISSPVFYAMFYGSMAEQKAEITVADSDADSFMELLRYAYFDEATINEENVL 2835 Query: 356 SFISTAEQLQVKGLTGNQ 409 + A++ + L N+ Sbjct: 2836 GVLYLAKKYILPFLADNK 2853 >SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) Length = 133 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +2 Query: 179 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 331 + AHK VL+ SP F+ MF K+ T I L D + + ++L+++Y+ EV Sbjct: 10 IPAHKYVLATSSPVFEAMFFGKLAETSRNIT-LPDCFYEGVLEMLRYLYRDEV 61 >SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 34.7 bits (76), Expect = 0.081 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +2 Query: 179 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 331 + AHK VL+ SP F+ MF K+ T I L D S + ++L+F+Y E+ Sbjct: 41 IPAHKYVLATSSPVFEAMFFGKLAETGFTIA-LPDCSAEGMLEMLRFIYTEEI 92 >SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 2/92 (2%) Frame = +2 Query: 128 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRD 301 L++ L D+T +G + AH++VL S M K ++ L DV + Sbjct: 65 LNKALLSDITFVVKGVSVPAHRVVLITRSAVMAAMLDGKFRENDLAMIELPDVPLAPFLI 124 Query: 302 LLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 LL+++Y N+K + A++ + GL Sbjct: 125 LLEYIYTDSCNLKDTNAREVLVLADRFCLDGL 156 >SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 2/92 (2%) Frame = +2 Query: 128 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRD 301 L++ L D+T +G + AH++VL S M K ++ L DV + Sbjct: 287 LNKALLSDITFVVKGVSVPAHRVVLITRSAVMAAMLDGKFRENDLAMIELPDVPLAPFLI 346 Query: 302 LLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 LL+++Y N+K + A++ + GL Sbjct: 347 LLEYIYTDSCNLKDTNAREVLVLADRFCLDGL 378 >SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 128 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKD 277 L GD DV G+ AH+ +L+ S YF MF+ ++ LK+ Sbjct: 84 LESGDFADVCFVIHGQRFCAHRAILTTRSSYFASMFETKWKDKHVITLKN 133 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 33.5 bits (73), Expect = 0.19 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 3/96 (3%) Frame = +2 Query: 53 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 232 M ++ F L + +S+ L +L DVT E AH+++L+ S YF+ + Sbjct: 1 MGDNQDFQLAKIDHVELLSSQSGTLYQSRELTDVTFIVEKTKFTAHRVILAARSEYFRAL 60 Query: 233 F--KMNPTQHPI-VFLKDVSHSALRDLLQFMYQGEV 331 M I + + D S A LL+++Y G++ Sbjct: 61 LFGGMREANPGIEIEVADASSIAFDALLRYIYTGKM 96 >SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) Length = 998 Score = 31.1 bits (67), Expect = 1.00 Identities = 24/106 (22%), Positives = 52/106 (49%), Gaps = 2/106 (1%) Frame = +2 Query: 86 NNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIV 265 N+F + + L + D+T++ G+ ++AHK VL+ S ++ T+ + Sbjct: 750 NSFVSRLLKTVADLYDKDLYSDITVSFGGQKIKAHKFVLAARSDHWCSRDLNEVTE---L 806 Query: 266 FLKDVSHSALRDLLQFMYQGEVNVKQEE--LASFISTAEQLQVKGL 397 L DVS L++++Y + + +EE L + + + + ++K L Sbjct: 807 ELSDVSVDVGLTLMKWVYTDKAQIPKEESFLINLVHASNKYRLKDL 852 >SB_47975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = +3 Query: 627 IHWKQVPLVLQKTNL*RYQTK--MXPMLSL 710 +H++ +P V+QKTNL RY K P+L+L Sbjct: 24 VHFRSMPRVVQKTNLTRYNLKGYRDPLLAL 53 >SB_37935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 216 GEHTDRTNLCACNNLPSAANVTSTRSPRDSRP 121 G H D L CN P + VTS + D+RP Sbjct: 81 GNHVDSLALSKCNATPEISEVTSVQELLDARP 112 >SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07) Length = 656 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 216 GEHTDRTNLCACNNLPSAANVTSTRSPRDSRP 121 G H D L CN P + VTS + D+RP Sbjct: 527 GNHVDSLALSKCNATPEISEVTSVQELLDARP 558 >SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 628 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/53 (20%), Positives = 30/53 (56%) Frame = +2 Query: 239 MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 397 M+ ++ V L+++ A+++++ F Y G++ + + + + A LQV+ + Sbjct: 66 MSESRQDTVTLQELDEKAMQNMIDFFYSGKIEISELNVQEVLPIACLLQVQSV 118 >SB_56853| Best HMM Match : BTB (HMM E-Value=1.1e-16) Length = 605 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +2 Query: 179 LQAHKLVLSVCSPYFQEMF-KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELA 355 + AHK +L V SP F MF T V L D L + L+++Y V E Sbjct: 47 IPAHKYILGVSSPVFFAMFYGQMSTSISKVELPDCDSVGLIEFLRYLYCNRVKFTMESAI 106 Query: 356 SFISTAEQLQVKGL 397 + +++ V L Sbjct: 107 QALYLSKKYLVPSL 120 >SB_58368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 3.0 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = -1 Query: 621 HFRFAG-PLCEEEELFDAIDGLFGL--LTATGVEEGLESRSVSNLVITDCLCCDDLGPGL 451 H R +G PLC + +G F LT T +E LES ++++L I CDD+ G+ Sbjct: 66 HARSSGSPLCFYLKPVSLSNGRFSFEDLTYTSLEVVLESSTIASLCIFR-RSCDDVMNGI 124 Query: 450 EV 445 EV Sbjct: 125 EV 126 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 29.1 bits (62), Expect = 4.0 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 4/90 (4%) Frame = +2 Query: 143 LVDVTLAAEG--RLLQAHKLVLSVCSPYFQEMFKMNPTQH--PIVFLKDVSHSALRDLLQ 310 L DV + A+ R AH+ VL+ S YF +++ L + L ++ Sbjct: 3582 LCDVIILADNGCRRFPAHRAVLAASSRYFHKLYNGTTLARYSRETILSGICDRELETVVH 3641 Query: 311 FMYQGEVNVKQEELASFISTAEQLQVKGLT 400 ++Y EV + + + + + A L + LT Sbjct: 3642 YIYTSEVCIDGDNVRALLHAAYNLGLDLLT 3671 >SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) Length = 604 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 125 LLSRGDLVDVTLAAEGRL--LQAHKLVLSVCSPYFQEMFKMNPTQH 256 +L R DV+ L LQAH+ VLS+ S +F++ F+ H Sbjct: 303 MLDRSTCYDVSFRFGSNLPLLQAHRFVLSIGSEWFRDFFENQDHLH 348 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/64 (21%), Positives = 33/64 (51%) Frame = +2 Query: 131 SRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQ 310 ++ L ++ L+ + R+ Q + +C+P F ++ M+P + + L ++ D ++ Sbjct: 512 AKDGLPEMKLSCKSRIFQCSRGAGVICTPPFFDLNIMSPMRVNLEVLSTSKNAKCSDPVE 571 Query: 311 FMYQ 322 F YQ Sbjct: 572 FTYQ 575 >SB_9607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 101 NMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF 235 N + H D D+ L E + HK++L + SP F+ MF Sbjct: 13 NETEDSHPFSKPWDDSDIILEVEEQEFYVHKMILKMASPVFKAMF 57 >SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 1163 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 745 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 774 >SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/86 (19%), Positives = 39/86 (45%) Frame = +2 Query: 149 DVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGE 328 DV L + AH+ +LS P E + + + L+ + H+A++ ++ ++Y Sbjct: 39 DVLLEVGDSEIAAHRAILSASIPVLSERLS-DRKEGLKIKLEGLQHNAVKAIVDYLYTSC 97 Query: 329 VNVKQEELASFISTAEQLQVKGLTGN 406 ++V + + + A L + L + Sbjct: 98 LDVPADSVLNVYLAARSLGMNELVSD 123 >SB_35972| Best HMM Match : DUF1379 (HMM E-Value=5.5) Length = 325 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 234 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 263 >SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1229 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 679 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 708 >SB_12746| Best HMM Match : DUF1379 (HMM E-Value=5.5) Length = 398 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 172 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 201 >SB_10735| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1013 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 93 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 122 >SB_54171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 51 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 80 >SB_48899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 209 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 238 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 198 TNLCA-CNNLPSAANVTSTRSPRDSRP*KPADIFAWKLFQHSENCSSD 58 T++C C N P+ N +S +PR + + D A L++ S C SD Sbjct: 299 TSVCVTCANGPNGRNCSSCVAPRAPKDGECMDTCAPDLYEKSGKCVSD 346 >SB_36000| Best HMM Match : DUF1379 (HMM E-Value=4.8) Length = 420 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 272 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 301 >SB_32624| Best HMM Match : rve (HMM E-Value=0.00042) Length = 415 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 93 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 122 >SB_23421| Best HMM Match : rve (HMM E-Value=1.8e-18) Length = 838 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 286 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 315 >SB_21695| Best HMM Match : RVT_1 (HMM E-Value=0.00068) Length = 1502 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 608 AKRKCVDPLEAGPSGSAKDEFVTIPDEDXT 697 A+ K D + P+GS E +T+PD+ T Sbjct: 999 ARHKAADAISRHPTGSTTPEMMTLPDDIAT 1028 >SB_39167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 312 NCNKSLSAE*LTSFKNTIGCCVGFILNIS*K*GEHTDRTNLCACNNLPSAANVTS 148 +CN + S TS+ N C N + + T N +CN+ S N TS Sbjct: 419 SCNGATSYNSATSYNNATSCNDATSYNNATSCNDATSYNNATSCNDATSYNNATS 473 >SB_17029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/82 (21%), Positives = 38/82 (46%), Gaps = 3/82 (3%) Frame = +2 Query: 140 DLVDVTLAAEGRL--LQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLK-DVSHSALRDLLQ 310 D+ + + G L + AHK +L++ SP F+ F + + + + L + L+ Sbjct: 25 DIEFAVVKSNGELDKIPAHKFILAIGSPVFESQFHGPMAEKDCRTINYNGTVEGLLEFLR 84 Query: 311 FMYQGEVNVKQEELASFISTAE 376 ++Y EV + Q + + A+ Sbjct: 85 YVYYDEVQLNQNVVMEVLHLAK 106 >SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 53 MASDEQFSLCWNNFHANMSAGFHGL 127 M S E WN F N++AG+H L Sbjct: 203 MMSYEGMQFDWNTFSVNLTAGYHQL 227 >SB_35867| Best HMM Match : Fibrinogen_C (HMM E-Value=6.5e-13) Length = 445 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -1 Query: 534 VEEGLESRSVSNLVITDCLCCDDLGPGLEVGFGLDGV 424 + EG+ SR S IT CD L + FGLDG+ Sbjct: 85 IREGIFSRLESMEWITCTQMCDQLDDCVSYNFGLDGM 121 >SB_27713| Best HMM Match : CKS (HMM E-Value=2.4) Length = 86 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 516 SRSVSNLVITDCLCCDDLGPGLEVGFGLDGV 424 SR + L++ LCCDD+ +E G GL V Sbjct: 21 SRPLLLLLLLARLCCDDMSERIERGIGLRDV 51 >SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 612 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/73 (27%), Positives = 32/73 (43%) Frame = +2 Query: 41 VVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPY 220 +VA +A D FS + F+ + GLL GDL G + A V++ + Sbjct: 487 LVATVARDAPFSGLYLMFYTQIKRRAKGLLQVGDLTSGQNFICGIMAGAMASVVTQPADV 546 Query: 221 FQEMFKMNPTQHP 259 + +MNP +P Sbjct: 547 VKTRLQMNPYMYP 559 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,642,146 Number of Sequences: 59808 Number of extensions: 370149 Number of successful extensions: 1023 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1011 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -