BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0819 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 33 0.19 SB_57725| Best HMM Match : Peptidase_C54 (HMM E-Value=3.8e-05) 31 0.76 SB_27293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_53432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_20619| Best HMM Match : Na_sulph_symp (HMM E-Value=0.0069) 29 3.0 SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) 29 4.0 SB_27553| Best HMM Match : Pyr_redox (HMM E-Value=1.1e-20) 29 5.3 SB_20283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_15612| Best HMM Match : Keratin_B2 (HMM E-Value=0.61) 29 5.3 SB_3656| Best HMM Match : bZIP_2 (HMM E-Value=1e-09) 28 9.3 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 33.5 bits (73), Expect = 0.19 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 1/149 (0%) Frame = +2 Query: 164 HNRQKREAPYVIYPEILVIVDYDGYRLHGGDNVQIKRYFVSFWNGVDLRYKLLKGPXXXX 343 H RQ+R E+LV+ D + HG ++ Y ++ N V+ Y+ Sbjct: 184 HERQRRSVSTERNVEVLVVADRTMHEFHGA---ALEEYLLTVMNMVNNIYRDQSIGNAIN 240 Query: 344 XXXXXXXXXXXDATPYLERNRVGRDAIDSAAALTDMGKYLFRERRLPVY-DIAVAITKLD 520 D P L+ + I+S A + R P + D+AV +T+ D Sbjct: 241 IVVVRIIILKRDL-PDLDIGHHAGNTIESFCAWAS--RVNPRSDTHPKHHDVAVLVTRKD 297 Query: 521 MCRRQYANDACNRGTAGFAYVGGACVVNK 607 +C+ ++ C GT G A V G C K Sbjct: 298 ICKG--IDEPC--GTLGLAQVNGMCTSTK 322 >SB_57725| Best HMM Match : Peptidase_C54 (HMM E-Value=3.8e-05) Length = 223 Score = 31.5 bits (68), Expect = 0.76 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +1 Query: 322 EGAKDKDIYSWYHNFKGSGCHTLPREEQSRSGCHRLCCSSDRHGQVS 462 E ++K +YS H + SG H L E RS HR HG+VS Sbjct: 154 ESEQNKALYSHEHRVRSSGYHELTSEHGERSSGHRE--QPFGHGEVS 198 >SB_27293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -3 Query: 646 SSNDGY*IDLX*SLVHNASSSHVSKTCCPSIAGIVRV 536 S N GY ++V+ +S VS CCPS+AG+VR+ Sbjct: 132 SQNGGY--QFAATIVYISSGHFVS--CCPSVAGVVRM 164 >SB_53432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 643 KTLVGFSGI---IVAAHXXGHLLGAVHDGS 723 K L G SGI I+ AH H LG HDG+ Sbjct: 14 KALAGNSGIQASIIVAHEIAHTLGVGHDGA 43 >SB_20619| Best HMM Match : Na_sulph_symp (HMM E-Value=0.0069) Length = 215 Score = 29.5 bits (63), Expect = 3.0 Identities = 9/31 (29%), Positives = 21/31 (67%) Frame = +3 Query: 213 WSLLIMMGTGYMAATTCRSNVISYRFGTELI 305 W+++I++G+G+ A C+ + +S G +L+ Sbjct: 45 WNIIILLGSGFALAEACKVSGLSEWLGLQLV 75 >SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) Length = 337 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 218 IVDYDGYRLHGGDNVQIKRYFVSFWNGVDLRYK 316 I++ ++ DN+ K+Y +S WNG+DL K Sbjct: 10 IIESQAFKTPLWDNIATKKY-MSLWNGLDLEMK 41 >SB_27553| Best HMM Match : Pyr_redox (HMM E-Value=1.1e-20) Length = 1037 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = -3 Query: 604 VHNASSSHVSKTCCPSIAGIVRVLPSAHVKFGDRNGNIVDGQPPLSEQILAHVGQ 440 ++N + SK+ CP + + S +V++ ++VD P + E +L GQ Sbjct: 574 INNNAVMIFSKSFCPFCKKVKAIFESINVQYTAMELDLVDNGPAIQEALLEKSGQ 628 >SB_20283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -3 Query: 451 HVGQSCSRVDGIPT-YSVPLEVR-CGIPTP*NYDTSYRYPYPW 329 H+ + +RVDG PL+V G+P+P +Y S R P P+ Sbjct: 57 HLNDAVTRVDGSSEDIDKPLDVPFTGLPSPQSYKPSLRSPMPF 99 >SB_15612| Best HMM Match : Keratin_B2 (HMM E-Value=0.61) Length = 343 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/52 (36%), Positives = 22/52 (42%) Frame = +3 Query: 381 PHLTSRGTE*VGMPSTLLQL*PTWASICSERGGCPSTILPLRSPNLTCAEGN 536 P T T P+T QL P +I + G PS PLR P C E N Sbjct: 20 PPTTREPTNITMAPTTRGQLLPNMTTILTNTIGTPSPATPLR-PRFKCYETN 70 >SB_3656| Best HMM Match : bZIP_2 (HMM E-Value=1e-09) Length = 241 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 462 CSERGGCPSTILPLRSPNL 518 CS G CP ++LP++S NL Sbjct: 121 CSGDGTCPGSLLPVKSENL 139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,276,334 Number of Sequences: 59808 Number of extensions: 570511 Number of successful extensions: 1359 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1357 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -