BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0815 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 24 4.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 5.8 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 24 5.8 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 5.8 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 674 TLSYVLIESALPLRSF*KYCEWYRVFD 594 TLS V I LP + + CEW+ V + Sbjct: 165 TLSTVAIFVPLPADRWPRVCEWFAVME 191 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 732 ITLHKLFSLCKMTESHLNANAE 667 ITL KL LCK +S L + E Sbjct: 120 ITLEKLCELCKYIDSWLGSGKE 141 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -2 Query: 680 MLTLSYVLIESALPLRSF*KYCEWYRVFDVSSIKS-YTFNLNLTYSYEL 537 ++ S++ ES L ++ K C W+ D S K+ Y NL ++ SY+L Sbjct: 412 LIMKSFLCPESTLFDQTVLK-CNWWFYVDCKSSKNLYDSNLPVSKSYQL 459 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -2 Query: 680 MLTLSYVLIESALPLRSF*KYCEWYRVFDVSSIKS-YTFNLNLTYSYEL 537 ++ S++ ES L ++ K C W+ D S K+ Y NL ++ SY+L Sbjct: 420 LIMKSFLCPESTLFDQTVLK-CNWWFYVDCKSSKNLYDSNLPVSKSYQL 467 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,103 Number of Sequences: 2352 Number of extensions: 13627 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -