BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0814 (450 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 25 4.1 SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit Ssr4|Schizos... 25 5.4 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 25.4 bits (53), Expect = 4.1 Identities = 17/62 (27%), Positives = 24/62 (38%) Frame = +1 Query: 247 PFDLLLAXPAFPXCKPXPDDXVLTQALLKRHTELCXXPTDQXAVLSLFTKLQTVLXXIGV 426 P +L P P PD L Q +L+ LC V L + +T+L + V Sbjct: 213 PLTVLTQNPNLPKLLERPDINDLHQGILQELDSLCNCLGSSLDVKKLSKQRETLLSHMQV 272 Query: 427 AP 432 P Sbjct: 273 NP 274 >SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit Ssr4|Schizosaccharomyces pombe|chr 2|||Manual Length = 395 Score = 25.0 bits (52), Expect = 5.4 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +3 Query: 171 WTRYPRPGRDGAFTLQQTPSLDASSALRPFTSXTRFSXMQTGTRRLRAH 317 WT +P F + Q P+L + F S RF M + L H Sbjct: 58 WTLIDQPPDGSLFLVWQAPTLPSPPDGMHFMSNERFFNMDVAGKVLEIH 106 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,413,914 Number of Sequences: 5004 Number of extensions: 21417 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -