BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0813 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 25 1.0 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 5.3 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 7.1 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 22 7.1 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 7.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.3 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 116 TSLDWAAIISGGTSMVAVLEFTRSSWF 36 T+LDW ++S G + +LEF +F Sbjct: 305 TALDWFLLMSFGYCIATLLEFAGVHYF 331 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 242 GSYPLSPTTTAGST 283 G+Y L PTTTA T Sbjct: 374 GNYSLVPTTTASPT 387 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 582 FTNSQLDFGRFRDHFHAISI 523 +T SQ +G F +F +ISI Sbjct: 204 YTTSQQYYGHFAGNFSSISI 223 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 436 FITASGYLSARKIRSRFQTLVAQACDKCSY 525 F SGY S R+ + + +C KC Y Sbjct: 19 FDKCSGYPSIRQGTTSYCLGCGDSCHKCKY 48 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 535 RNLYTSTCHRPELPTFGSATVSCAPIGIPK 446 +N+ S +P+L FGS+ + AP I K Sbjct: 184 KNILMSKNGQPKLTDFGSSVLIGAPNEIDK 213 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 602 PRRSSAPACGRGPXHTGPFPAIPWPXSN 685 P+R S P +GP GP P P P N Sbjct: 34 PQRGSPPNPSQGPPPGGP-PGAP-PSQN 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,733 Number of Sequences: 438 Number of extensions: 4866 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -