BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0808 (588 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pomb... 32 0.071 SPCC191.09c |gst1||glutathione S-transferase Gst1|Schizosaccharo... 27 1.5 SPBC17D11.06 |spp2|pri2|DNA primase large subunit Spp2 |Schizosa... 26 3.5 >SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pombe|chr 2|||Manual Length = 1136 Score = 31.9 bits (69), Expect = 0.071 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +1 Query: 82 YKRIL*NDG--FIQFLFYISHFYYYNLRFSL-PSNHVSHFNYIDFIFFVSD 225 YKR+L N+ F + + Y+ HF L + PSN V++ NY + + F+ D Sbjct: 494 YKRLLYNEWERFAKLVAYLDHFGDEILSINFDPSNAVTYINYANKVAFIRD 544 >SPCC191.09c |gst1||glutathione S-transferase Gst1|Schizosaccharomyces pombe|chr 3|||Manual Length = 229 Score = 27.5 bits (58), Expect = 1.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 121 LFYISHFYYYNLRFSLPSNHVSHFNYIDFIFF 216 L Y++ Y + SLP +H ++ I ++FF Sbjct: 75 LIYLADKYDTERKISLPRDHPEYYKVIQYLFF 106 >SPBC17D11.06 |spp2|pri2|DNA primase large subunit Spp2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 26.2 bits (55), Expect = 3.5 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -2 Query: 122 KNCINPSFYKIRLYKVPKTIIIYTECKKMTVYKNYSF 12 +N N SF+K+ +KVP + E + + V+K Y++ Sbjct: 180 RNIENESFFKVPFFKVPDLV----ERRAVFVHKGYAY 212 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,080,038 Number of Sequences: 5004 Number of extensions: 36690 Number of successful extensions: 85 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -