BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-0808
(588 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-2575|AAF55590.1| 218|Drosophila melanogaster CG7715-PA... 28 8.2
>AE014297-2575|AAF55590.1| 218|Drosophila melanogaster CG7715-PA
protein.
Length = 218
Score = 28.3 bits (60), Expect = 8.2
Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
Frame = -1
Query: 300 ALYIIFMISISRKRLQYTLRCNRR--SIRHKKYKIN 199
AL + ++++S+ RL YTL+C R SIR Y N
Sbjct: 5 ALCFLSLLALSQARLDYTLQCARGEISIRWPSYHSN 40
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,679,898
Number of Sequences: 53049
Number of extensions: 344442
Number of successful extensions: 628
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 628
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2358819486
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -