BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0802 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 26 0.33 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 26 0.33 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 25 0.76 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.76 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 25 1.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 1.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 25 1.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 1.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 1.0 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 1.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 1.0 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 1.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 1.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 25 1.0 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 1.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 1.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 25 1.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 1.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 25 1.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 25 1.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 1.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 23 2.3 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.3 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 23 2.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.3 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 9.3 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 26.2 bits (55), Expect = 0.33 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H+ H + +RER Sbjct: 208 KKYATSSNSLRNRTHDFQHTSSRYSRER 235 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 26.2 bits (55), Expect = 0.33 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H+ H + +RER Sbjct: 208 KKYATSSNSLRSRTHDFQHTSSRYSRER 235 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 25.0 bits (52), Expect = 0.76 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +1 Query: 469 TPRTKRQLEEGSSAEENSLGDSSEATLPNIAKKLRKATH*HPRAVPHQT 615 T R K + +GS N L + A L N +KL+ P H T Sbjct: 38 TKRPKTKKSQGSRTTHNELEKNRRAHLRNCLEKLKVLVPLGPETSRHTT 86 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.0 bits (52), Expect = 0.76 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -3 Query: 163 LKNSQPLKIIIAQKKHQEFHFSGKKYKLAGNTTRKSSHEL*HRGHKATRER 11 +K + ++ +K E KKY + N+ R +H H + +RER Sbjct: 178 IKEHDTVLVVNIEKSENE----SKKYATSSNSLRNRTHGFQHTSSRYSRER 224 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSRYSRER 224 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSRYSRER 224 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 197 KKYATSSNSLRNRTHGFQHTSSRYSRER 224 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRER 235 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRER 235 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 197 KKYATSSNSLRNRTHGFQHTSSRYSRER 224 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRER 235 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 213 KKYATSSNSLRNRTHGFQHTSSRYSRER 240 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRER 235 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRER 235 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H + +RER Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRER 235 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 443 QTTQTLQSARHELKDNWRKVVRRKKT 520 + +TLQS H KD + ++ R K+T Sbjct: 34 ENCETLQSEVHITKDEYDEIGRLKRT 59 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRER 235 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRER 235 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRER 235 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRER 235 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H +RER Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSHYSRER 224 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 94 KKYKLAGNTTRKSSHEL*HRGHKATRER 11 KKY + N+ R +H H +RER Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRER 235 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 443 QTTQTLQSARHELKDNWRKVVRRKKT 520 + +TLQS H KD + ++ R K+T Sbjct: 34 ENCETLQSEVHITKDEYDEIGRLKRT 59 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 153 EFLSEKFVCLVTCTAIRNSLNGILIFGFKHNS 248 E + + F +T A+ S NG+L+FG +N+ Sbjct: 295 ERVQDVFDSQLTVKAV--SKNGVLLFGLANNT 324 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 241 TIVSDLTYNKSLDQC 285 T + DL YN+S +QC Sbjct: 548 TYLFDLDYNESEEQC 562 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 207 SLNGILIFGFKHNS 248 S NG+L FG +NS Sbjct: 313 SKNGVLFFGLMNNS 326 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,060 Number of Sequences: 438 Number of extensions: 3641 Number of successful extensions: 37 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -