BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0799 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125964-2|AAD14754.1| 726|Caenorhabditis elegans Hypothetical ... 33 0.18 AF036692-6|AAB88328.1| 397|Caenorhabditis elegans Hypothetical ... 30 1.6 Z74037-2|CAD36492.1| 441|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z74037-1|CAA98492.1| 510|Caenorhabditis elegans Hypothetical pr... 29 3.8 >AF125964-2|AAD14754.1| 726|Caenorhabditis elegans Hypothetical protein W03G1.6a protein. Length = 726 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +2 Query: 239 GGIQIELVVCENKAMEKKGLKMRRISGDQREYGKLCEQLI 358 G + +EL + + +K G++ +R+ GD Y K+CE+++ Sbjct: 681 GWMTVELEIVRLQMFDKVGIRRKRLKGDAFMYKKVCEKIL 720 >AF036692-6|AAB88328.1| 397|Caenorhabditis elegans Hypothetical protein C44B12.5 protein. Length = 397 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = -3 Query: 378 IQTVKLVMSCSHSFPYSL*SPEILLIFKPFFSMALFSHTTSSI*IPPEYSRFM*PLSPSL 199 +Q + C FP S+ S IF F + FS + PP Y P +PS Sbjct: 2 VQIYRSSFQCFLFFPRSINSDISTFIFLKLFLLIFFSVGGAHPMFPPNYKSMAPPTNPSF 61 Query: 198 ATFS 187 FS Sbjct: 62 DRFS 65 >Z74037-2|CAD36492.1| 441|Caenorhabditis elegans Hypothetical protein F57B7.1b protein. Length = 441 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 275 CFRTRPARFEFHQNILDLCSRCLRLWPPSPRRYSEA 168 C + R EFH+ + RCLR+ PS RR S+A Sbjct: 364 CSMSGQFRNEFHRVFVPAKVRCLRMSSPSIRRPSDA 399 >Z74037-1|CAA98492.1| 510|Caenorhabditis elegans Hypothetical protein F57B7.1a protein. Length = 510 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 275 CFRTRPARFEFHQNILDLCSRCLRLWPPSPRRYSEA 168 C + R EFH+ + RCLR+ PS RR S+A Sbjct: 364 CSMSGQFRNEFHRVFVPAKVRCLRMSSPSIRRPSDA 399 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,067,029 Number of Sequences: 27780 Number of extensions: 355383 Number of successful extensions: 940 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -