BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0797 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 25 0.43 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.1 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 24.6 bits (51), Expect = 0.43 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 107 FNDSSCKYFVWFNRACLIIPIFNVKTKHRQKRVKSF 214 +N+++ KY+ W N CL + I + K+++ F Sbjct: 48 YNNTNRKYY-WLNVCCLNLSIVTIFFNFATKKLEQF 82 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.0 bits (47), Expect = 1.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 180 RRNTDRNA*NLSNSTFYNYLTSHY 251 RRN + A + N FY++L++ Y Sbjct: 234 RRNFSKQASEILNEYFYSHLSNPY 257 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 207 NLSNSTFYNYLTSHYLH 257 N + TF+N L YLH Sbjct: 1189 NRNEETFWNELIEQYLH 1205 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 207 NLSNSTFYNYLTSHYLH 257 N + TF+N L YLH Sbjct: 1189 NRNEETFWNELIEQYLH 1205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,603 Number of Sequences: 336 Number of extensions: 1596 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -