BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0796 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_55279| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_27135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/75 (25%), Positives = 38/75 (50%) Frame = +1 Query: 235 LFITLLRYVRSIPSKFRICAFFLYVYVSSQT*INLLHSLLSMNFIGINIKHYNALKMK*L 414 L I +L + ++ +FR+ ++ + ++V + LL +L IG+ Y+A + L Sbjct: 135 LLIVILYAILALYGQFRVVSWIITIWVLGSLIVFLLARVLGGEAIGVVWASYSAGSL--L 192 Query: 415 KKMDVCKRRKVLTYP 459 D+ +R +L YP Sbjct: 193 IHEDLRSKRPLLLYP 207 >SB_55279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 579 TIIFK*INGISVAAILIERIINIFRCYVGTMKIFLTFI*LMKCAFCW 719 TI F + +++ I IER ++I+R Y +IF + + AF W Sbjct: 249 TIFFGGTSNLTILFISIERFVSIYRPY-AYCRIFTDMVVKVVIAFSW 294 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,069,919 Number of Sequences: 59808 Number of extensions: 396350 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -