BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0796 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024859-16|AAK29984.1| 375|Caenorhabditis elegans Hypothetical... 29 3.5 Z78414-2|CAB01668.3| 308|Caenorhabditis elegans Hypothetical pr... 28 8.1 >AC024859-16|AAK29984.1| 375|Caenorhabditis elegans Hypothetical protein Y71H2AM.20a protein. Length = 375 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +2 Query: 575 LNNYFQVN*WYFCRCYFN*TNNKHFSLLRRYDENIFDFHLANEMR 709 + N F +N WYF + Y ++ + L R ++++ H +MR Sbjct: 13 IKNVFDLNPWYFSKAY-----EEYLAFLHRLNDSVVGVHTTADMR 52 >Z78414-2|CAB01668.3| 308|Caenorhabditis elegans Hypothetical protein W09D12.2 protein. Length = 308 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = +1 Query: 241 ITLLRYVRSIPSKFRICAFFLYVYVSSQT*INLLHSLLSMNFIGINIKHY 390 IT+ + + +PS +C FF+ +++ N + L+ ++ I +NI Y Sbjct: 4 ITIFQMIYGVPSFCLMCFFFILIFIDRNNLSNPFYRLVQID-IFVNITCY 52 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,667,041 Number of Sequences: 27780 Number of extensions: 345807 Number of successful extensions: 626 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -