Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0795
         (750 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative acetyltr...    27   0.47 

>AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative
           acetyltransferase protein.
          Length = 471

 Score = 27.5 bits (58), Expect = 0.47
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 10/63 (15%)
 Frame = +2

Query: 107 RDHADGINNIMLTNDPH---------VRHGLYRENRNTIYCVY-NRPQNDITIIDNYYTK 256
           R+   G++  +L ++PH             LY   +N  Y  Y N  ++D T  D Y  K
Sbjct: 163 RNEPRGVSKFILASEPHRYVVQRYESSEEELYARRQNCYYYYYYNEEEDDDTYQDYYSCK 222

Query: 257 KRV 265
           KR+
Sbjct: 223 KRI 225


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 730,382
Number of Sequences: 2352
Number of extensions: 14197
Number of successful extensions: 63
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 62
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 77339358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)