BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0795 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71186-3|CAA94914.1| 222|Caenorhabditis elegans Hypothetical pr... 29 3.5 Z92826-8|CAI79117.1| 325|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z81475-12|CAI79149.1| 325|Caenorhabditis elegans Hypothetical p... 28 6.2 Z78015-7|CAB01438.1| 381|Caenorhabditis elegans Hypothetical pr... 28 8.1 Z77657-10|CAB01152.1| 381|Caenorhabditis elegans Hypothetical p... 28 8.1 >Z71186-3|CAA94914.1| 222|Caenorhabditis elegans Hypothetical protein F23D12.4 protein. Length = 222 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 238 NNSDVVLRSIIYTINRISVLTIQAVPN-VRIIG 143 NNSD V + II ++R+S L I PN R++G Sbjct: 186 NNSDEVFKCIIDEVSRVSSLQIWGFPNGERLLG 218 >Z92826-8|CAI79117.1| 325|Caenorhabditis elegans Hypothetical protein C18D11.7 protein. Length = 325 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 92 IFNKLRDHADGINNIMLTNDPHV 160 +FNKLRD + GI +L DP V Sbjct: 150 VFNKLRDSSSGIEITLLDVDPEV 172 >Z81475-12|CAI79149.1| 325|Caenorhabditis elegans Hypothetical protein C18D11.7 protein. Length = 325 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 92 IFNKLRDHADGINNIMLTNDPHV 160 +FNKLRD + GI +L DP V Sbjct: 150 VFNKLRDSSSGIEITLLDVDPEV 172 >Z78015-7|CAB01438.1| 381|Caenorhabditis elegans Hypothetical protein F08H9.9 protein. Length = 381 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -3 Query: 331 GTHVGTFGPLTIFY*LLYVKSCNAFFSVIIINNSDVVLRSIIYTI-NRISVLTIQAVPN 158 G H T + Y + Y + + F+S+ NN+ + L+ Y + N I LTI PN Sbjct: 163 GLHTRTGNITSPGYPVQYYNNLDCFYSITSPNNTYITLQLDPYLVENAIDYLTIYDGPN 221 >Z77657-10|CAB01152.1| 381|Caenorhabditis elegans Hypothetical protein F08H9.9 protein. Length = 381 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -3 Query: 331 GTHVGTFGPLTIFY*LLYVKSCNAFFSVIIINNSDVVLRSIIYTI-NRISVLTIQAVPN 158 G H T + Y + Y + + F+S+ NN+ + L+ Y + N I LTI PN Sbjct: 163 GLHTRTGNITSPGYPVQYYNNLDCFYSITSPNNTYITLQLDPYLVENAIDYLTIYDGPN 221 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,559,451 Number of Sequences: 27780 Number of extensions: 312558 Number of successful extensions: 565 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -