BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0787 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0499 - 19725896-19726339,19726918-19726960,19727286-197273... 29 3.9 >12_02_0499 - 19725896-19726339,19726918-19726960,19727286-19727389, 19727784-19728539 Length = 448 Score = 29.1 bits (62), Expect = 3.9 Identities = 10/60 (16%), Positives = 32/60 (53%) Frame = -3 Query: 205 SQPLHIKKSCSMYNVIGKSMKNILDVFSPLKMSSKLFIVSHIKNALGARTLRRLHLSTPK 26 ++P + ++ +I + + + + ++++ +F+++H + R + + HL+TPK Sbjct: 239 AEPTEARPLQGLWKLIARLRLHTKGIMAIMQLTGWVFLLAHALGYMTCRNMEKSHLATPK 298 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,629,006 Number of Sequences: 37544 Number of extensions: 317378 Number of successful extensions: 651 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -