BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0786 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0012 - 20221635-20221954,20221988-20222064,20222580-202226... 29 3.0 03_06_0382 - 33530943-33530966,33531160-33531360,33535494-33537026 29 3.9 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 28 6.9 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 28 9.1 04_03_0897 - 20646750-20646918,20647927-20648038,20649650-206501... 28 9.1 03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660... 28 9.1 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 9.1 >09_06_0012 - 20221635-20221954,20221988-20222064,20222580-20222698, 20223244-20223558 Length = 276 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/79 (27%), Positives = 29/79 (36%), Gaps = 6/79 (7%) Frame = -3 Query: 700 WWIQVRGEVGLARCAAPSAPSGRTATNAF-----HGVP*AFFRRLNTTFGSSHSASSAYQ 536 WW +VRGEV C P R + HG R +T + S Y Sbjct: 156 WWFEVRGEVEF--CFPEGRPLKRLGRRVYSSEHIHGWDIKPVRFQLSTSDGQQAQSKCYL 213 Query: 535 NWP-TWHRHQISGFIVRVS 482 P W H + F+V+ S Sbjct: 214 TDPGVWINHHVGDFVVKSS 232 >03_06_0382 - 33530943-33530966,33531160-33531360,33535494-33537026 Length = 585 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 628 LSSLTEPREPRTVLAR--PRPVPESTTSRPHEPTIGFRKNLIT 750 LSSL E R R + R PRP P + +S EP LIT Sbjct: 48 LSSLQESRSARIRIPRDEPRPTPPARSSSREEPRFVAETKLIT 90 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 542 LPKLAHLAPSSDLRLHRSSKPEFSPI 465 L L +LAP DLR+ SSKP F I Sbjct: 259 LETLVNLAPVLDLRIFSSSKPSFIKI 284 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 281 KSIVGTGYRGERLIEPSSSWFRPKFPSG 364 + + GTG + PSS+WF P+ SG Sbjct: 12 RCVFGTGPLPPASLSPSSAWFDPELSSG 39 >04_03_0897 - 20646750-20646918,20647927-20648038,20649650-20650108, 20650237-20650330,20650449-20650525,20650637-20650688, 20650770-20650927,20651191-20651281,20651465-20652529 Length = 758 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 208 DGELCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKT 318 DG+ +V + SGE D+S ++Q+D+ ++ G+K+ Sbjct: 436 DGKGFIVGTTSGECRFYDQSGENIQLDKELFMQGKKS 472 >03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048, 13266361-13266623,13267637-13267847,13268420-13268590, 13268671-13268748,13269275-13269520,13269763-13271868, 13272122-13273904,13274113-13274216,13274752-13275108, 13275210-13275328,13276175-13276436,13276669-13276893, 13277075-13277214,13278087-13278159,13278431-13278532, 13278647-13279018,13279183-13279230,13279516-13279900, 13280440-13280558 Length = 2574 Score = 27.9 bits (59), Expect = 9.1 Identities = 22/92 (23%), Positives = 36/92 (39%) Frame = -3 Query: 733 GSRWLVHEVVRWWIQVRGEVGLARCAAPSAPSGRTATNAFHGVP*AFFRRLNTTFGSSHS 554 G+R + VV+ + E R +A SGR +FH + GSS+ Sbjct: 1820 GTRHFMVNVVQPQFNLHSEEANGRFLL-AAGSGRVLVRSFHSIVHVGQEMFEKALGSSNV 1878 Query: 553 ASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 458 A + +W R+++S + V P V Sbjct: 1879 AIGETRPEMSWSRYEVSVMLEHVQAHVAPTDV 1910 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 9.1 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 462 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 301 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,874,927 Number of Sequences: 37544 Number of extensions: 506959 Number of successful extensions: 1333 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -