BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0786 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.57 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 25 0.76 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 5.3 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 5.3 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 5.3 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 5.3 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 5.3 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 5.3 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 5.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.3 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 7.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 7.1 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 9.3 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.57 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 491 NDEAGDLMTVPSGPILVSRTGA 556 ND+ D +T P P+ +SR G+ Sbjct: 1387 NDDGSDRLTSPPTPLSISRAGS 1408 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.0 bits (52), Expect = 0.76 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 697 WIQVRGEVGLARCAAPSAPSGR-TATNAFHGVP*AFFRRLNTTFGSSH 557 WI V+ +V RC P P R NA+ F LN FG +H Sbjct: 138 WISVQEQVPRFRCIGPPTPFPRFIPPNAYR-----FRPPLNPRFGPTH 180 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.3 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -1 Query: 507 SPASSFE*AGVLTHLKFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGN 352 S A+S E + TH + ++LR R S L DE K + ++ EGN Sbjct: 220 STAASDEDISLTTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGN 271 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 105 MVRPWVPMRGQVPGSRHIGPLTP 127 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 353 MVRPWVPMRGQVPGSRHIGPLTP 375 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 338 MVRPWVPMRGQVPGSRHIGPLTP 360 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 709 VVRWWIQVRGEVGLARCAAPSAP 641 +VR W+ +RG+V +R P P Sbjct: 354 MVRPWVPMRGQVPGSRHIGPLTP 376 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 315 LSPLYPVPTID 283 LSP+YP P +D Sbjct: 71 LSPIYPSPMVD 81 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 315 LSPLYPVPTID 283 LSP+YP P +D Sbjct: 71 LSPIYPSPMVD 81 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 307 PIPSSDDRFARQNRYGPPSGFP 242 P S ++ R GPP+ FP Sbjct: 364 PFVSIQEQIPRLRYIGPPTSFP 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,625 Number of Sequences: 438 Number of extensions: 4816 Number of successful extensions: 26 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -