SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0784
         (818 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0153 + 18635495-18636952,18637262-18637333,18637448-186375...    28   7.8  

>01_05_0153 +
           18635495-18636952,18637262-18637333,18637448-18637595,
           18637690-18637871
          Length = 619

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 10/34 (29%), Positives = 21/34 (61%)
 Frame = +3

Query: 141 PSETRNIEKRDVMESMKNAWNEVVKTLSDAGDAV 242
           P ET N  + +++E+  N  +++V T  + G+A+
Sbjct: 298 PDETENRSQEEIVEASLNVLHKLVSTTGETGEAL 331


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,284,496
Number of Sequences: 37544
Number of extensions: 350776
Number of successful extensions: 791
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 771
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 791
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2244686244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -